Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Human

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Human is produced in E. coli , and consists of 70 amino acids (A59-D128) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-human.html

Purity

97.00

Smiles

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Formula

5473 (Gene_ID) P02775 (A59-D128) (Accession)

Molecular Weight

Approximately 8-19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Oda M, et al. Thrombopoietin-induced CXC chemokines, NAP-2 and PF4, suppress polyploidization and proplatelet formation during megakaryocyte maturation. Genes Cells. 2003 Jan;8 (1) :9-15.|[2]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[3]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.|[4]Laurens Kruidenier, et al. Myofibroblast matrix metalloproteinases activate the neutrophil chemoattractant CXCL7 from intestinal epithelial cells. Gastroenterology. 2006 Jan;130 (1) :127-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant SIRT1 (phospho S47) Antibody
RC-16352-01 50 μL

Recombinant SIRT1 (phospho S47) Antibody

Sign In for Pricing
View Details
Recombinant SIRT1 (phospho S47) Antibody
RC-16352-02 100 µL

Recombinant SIRT1 (phospho S47) Antibody

Sign In for Pricing
View Details
Recombinant SIRT1 (phospho S47) Antibody
RC-16352-03 1 mL

Recombinant SIRT1 (phospho S47) Antibody

Sign In for Pricing
View Details
MLH1 Mouse Monoclonal Antibody [Clone ID: OTI6E8]
CF811848 100 µg

MLH1 Mouse Monoclonal Antibody [Clone ID: OTI6E8]

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), Biotin conjugate, 0.1mg/mL
BNCB0812-100 1x 100 µL

Tyrosinase (OCA1/812), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXD4L5 (NM_001126334) Human Over-expression Lysate
LC426675 20 µg

FOXD4L5 (NM_001126334) Human Over-expression Lysate

Sign In for Pricing
View Details