Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAP-2/CXCL7, Human

CXCL7 (also known as neutrophil activating peptide 2, NAP-2) is a platelet-derived growth factor that belongs to the ELR+ CXC chemokine family, functioning as a potent chemoattractant and activator of neutrophils through binding to its receptor CXCR2[1]. NAP-2/CXCL7 Protein, Human is produced in E. coli , and consists of 70 amino acids (A59-D128) .

Product Specifications

Product Name Alternative

NAP-2/CXCL7 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/nap-2-cxcl7-protein-human.html

Purity

97.00

Smiles

AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Formula

5473 (Gene_ID) P02775 (A59-D128) (Accession)

Molecular Weight

Approximately 8-19 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Oda M, et al. Thrombopoietin-induced CXC chemokines, NAP-2 and PF4, suppress polyploidization and proplatelet formation during megakaryocyte maturation. Genes Cells. 2003 Jan;8 (1) :9-15.|[2]Qian Guo, et al. CXCL7 promotes proliferation and invasion of cholangiocarcinoma cells. Oncol Rep. 2017 Feb;37 (2) :1114-1122.|[3]Yu-Shan Wang, et al. Canine CXCL7 and its functional expression in dendritic cells undergoing maturation. Vet Immunol Immunopathol. 2010 May 15;135 (1-2) :128-136.|[4]Laurens Kruidenier, et al. Myofibroblast matrix metalloproteinases activate the neutrophil chemoattractant CXCL7 from intestinal epithelial cells. Gastroenterology. 2006 Jan;130 (1) :127-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FGD5 activation kit by CRISPRa
GA115830 1 Kit

Human FGD5 activation kit by CRISPRa

Sign In for Pricing
View Details
APP Monoclonal Antibody
TA399488 100 µg

APP Monoclonal Antibody

Sign In for Pricing
View Details
GGA1 Antibody (N-term) [APR14339G]
APR14339G-01 50 µL

GGA1 Antibody (N-term) [APR14339G]

Sign In for Pricing
View Details
GGA1 Antibody (N-term) [APR14339G]
APR14339G-02 100 µL

GGA1 Antibody (N-term) [APR14339G]

Sign In for Pricing
View Details
GGA1 Antibody (N-term) [APR14339G]
APR14339G-03 200 µL

GGA1 Antibody (N-term) [APR14339G]

Sign In for Pricing
View Details
GGA1 Antibody (N-term) [APR14339G]
APR14339G-04 400 µL

GGA1 Antibody (N-term) [APR14339G]

Sign In for Pricing
View Details