Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Serine protease inhibitor A3K (Serpina3k)

Product Specifications

Product Name Alternative

(Serpin A3K) (Contrapsin) (SPI-2)

Abbreviation

Recombinant Mouse Serpina3k protein

Gene Name

Serpina3k

UniProt

P07759

Expression Region

22-418aa

Organism

Mus musculus (Mouse)

Target Sequence

FPDGTKEMDIVFHEHQDNGTQDDSLTLASVNTDFAFSLYKKLALKNPDTNIVFSPLSISAALALVSLGAKGKTMEEILEGLKFNLTETPEADIHQGFGNLLQSLSQPEDQDQINIGNAMFIEKDLQILAEFHEKTRALYQTEAFTADFQQPTEAKNLINDYVSNQTQGMIKELISELDERTLMVLVNYIYFKGKWKISFDPQDTFESEFYLDEKRSVKVPMMKMKLLTTRHFRDEELSCSVLELKYTGNASALLILPDQGRMQQVEASLQPETLRKWRKTLFPSQIEELNLPKFSIASNYRLEEDVLPEMGIKEVFTEQADLSGITETKKLSVSQVVHKAVLDVAETGTEAAAATGVIGGIRKAILPAVHFNRPFLFVIYHTSAQSILFMAKVNNPK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Others

Relevance

Capsid proteins VP0, VP2, VP3 form a closed capsid enclosing the viral positive strand RNA genome. Capsid proteins interact with host alpha-V/beta-3 integrin heterodimer to provide virion attachment target cell. This attachment induces virion internalization predominantly through clathrin-mediated endocytosis.; [Protein 2A]: Is not a protease.; [Protein 2B]: Affects membrane integrity and cause an increase in membrane permeability.; [Protein 2C]: Associates with and induces structural rearrangements of intracellular membranes. It displays RNA-binding, nucleotide binding and NTPase activities.; Protein 3A, via its hydrophobic domain, serves as membrane anchor.; [Protease 3C]: Cysteine protease that generates mature viral proteins from the precursor polyprotein. In addition to its proteolytic activity, it binds to viral RNA, and thus influences viral genome replication. RNA and substrate bind cooperatively to the protease.; RNA-directed RNA polymerase 3D-POL replicates genomic and antigenomic RNA by recognizing replications specific signals.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

49.8 kDa

References & Citations

"Entry of human parechovirus 1." Joki-Korpela P., Marjomaki V., Krogerus C., Heino J., Hyypia T. J. Virol. 75:1958-1967 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

TMEM8C (MYMK) (NM_001080483) Human Tagged ORF Clone Lentiviral Particle
RC213632L3V 200 µL

TMEM8C (MYMK) (NM_001080483) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
Glutathione S Transferase Omega 1 (GSTO1) Antibody
abx018055 100 µg

Glutathione S Transferase Omega 1 (GSTO1) Antibody

Ask
View Details
Anti-GRIN2A Polyclonal Antibody
HC657014-01 50 µg

Anti-GRIN2A Polyclonal Antibody

Ask
View Details
Anti-GRIN2A Polyclonal Antibody
HC657014-02 100 µg

Anti-GRIN2A Polyclonal Antibody

Ask
View Details
Tissue Genomic DNA, Breast
CD565134 5 µg

Tissue Genomic DNA, Breast

Ask
View Details