Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Growth/differentiation factor 2 (GDF2), partial

Product Specifications

Product Name Alternative

Bone morphogenetic protein 9 Short name: BMP-9

Abbreviation

Recombinant Human GDF2 protein, partial

Gene Name

GDF2

UniProt

Q9UK05

Expression Region

300-429aa

Organism

Homo sapiens (Human)

Target Sequence

HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR

Tag

N-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cell Biology

Relevance

Potent circulating inhibitor of angiogenesis. Could be involved in bone formation. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Potent circulating inhibitor of angiogenesis. Signals through the type I activin receptor ACVRL1 but not other Alks. Signaling through SMAD1 in endothelial cells requires TGF-beta coreceptor endoglin/ENG.

Molecular Weight

16.3 kDa

References & Citations

"Bone morphogenetic protein-9 is a circulating vascular quiescence factor."David L., Mallet C., Keramidas M., Lamande N., Gasc J.M., Dupuis-Girod S., Plauchu H., Feige J.J., Bailly S.Circ. Res. 102:914-922 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEX5L Protein Vector (Mouse) (pPM-C-HA)
PV215224 500 ng

PEX5L Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
CNBr-activated Sepharose 4FF 10g
17098101 1 Each

CNBr-activated Sepharose 4FF 10g

Sign In for Pricing
View Details
SRD5A1 polyclonal antibody
BS60411 50ul

SRD5A1 polyclonal antibody

Sign In for Pricing
View Details
Olfr1113 Protein Vector (Mouse) (pPM-C-His)
PV208233 500 ng

Olfr1113 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 4E Antibody / EIF4E
V9192SAF-100UG 100 µg

Eukaryotic translation initiation factor 4E Antibody / EIF4E

Sign In for Pricing
View Details
Melanoma Discriminating Antigen
M2869-40B 1 mL

Melanoma Discriminating Antigen

Sign In for Pricing
View Details