Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse IgG receptor FcRn large subunit p51 (Fcgrt), partial

Product Specifications

Product Name Alternative

FcRn; IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor

Abbreviation

Recombinant Mouse Fcgrt protein, partial

Gene Name

Fcgrt

UniProt

Q61559

Expression Region

22-297aa

Organism

Mus musculus (Mouse)

Target Sequence

SETRPPLMYHLTAVSNPSTGLPSFWATGWLGPQQYLTYNSLRQEADPCGAWMWENQVSWYWEKETTDLKSKEQLFLEALKTLEKILNGTYTLQGLLGCELASDNSSVPTAVFALNGEEFMKFNPRIGNWTGEWPETEIVANLWMKQPDAARKESEFLLNSCPERLLGHLERGRRNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSSARSS

Tag

C-terminal 6xHis-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cancer

Relevance

Cell surface receptor that transfers passive humoral immunity from the mother to the newborn. Binds to the Fc region of monomeric immunoglobulin gamma and mediates its selective uptake from milk. IgG in the milk is bound at the apical surface of the intestinal epithelium. The resultant FcRn-IgG complexes are transcytosed across the intestinal epithelium and IgG is released from FcRn into blood or tissue fluids. Throughout life, contributes to effective humoral immunity by recycling IgG and extending its half-life in the circulation. Mechanistically, monomeric IgG binding to FcRn in acidic endosomes of endothelial and hematopoietic cells recycles IgG to the cell surface where it is released into the circulation. In addition of IgG, regulates homeostasis of the other most abundant circulating protein albumin/ALB.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

37.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MRQ30 Vial w PTFE/Si Cap - PK100
CHR2428 100 / PCK

MRQ30 Vial w PTFE/Si Cap - PK100

Sign In for Pricing
View Details
N-Des (dimethyl) -4-epi-tetracycline
008314 1 mg

N-Des (dimethyl) -4-epi-tetracycline

Sign In for Pricing
View Details
ASGR1 Antibody
A46757-100UG 100 µg

ASGR1 Antibody

Sign In for Pricing
View Details
PAR1 (Cleaved-Ser42) Polyclonal Antibody
RA28513-01 50 µL

PAR1 (Cleaved-Ser42) Polyclonal Antibody

Sign In for Pricing
View Details
PAR1 (Cleaved-Ser42) Polyclonal Antibody
RA28513-02 100 µL

PAR1 (Cleaved-Ser42) Polyclonal Antibody

Sign In for Pricing
View Details
SERPINB9, Control Peptide (Serpin B9, Cytoplasmic Antiproteinase 3, CAP-3, CAP3, Peptidase Inhibitor 9, PI-9, PI9)
148486 100 µg

SERPINB9, Control Peptide (Serpin B9, Cytoplasmic Antiproteinase 3, CAP-3, CAP3, Peptidase Inhibitor 9, PI-9, PI9)

Sign In for Pricing
View Details