TM4SF2/TSPAN7, Human (HEK293, His)
TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.
Product Specifications
Product Name Alternative
TM4SF2/TSPAN7 Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-human-hek293-his.html
Purity
95.00
Smiles
RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM
Molecular Formula
7102 (Gene_ID) AAH18036.1 (R113-M213) (Accession)
Molecular Weight
Approximately 21-30 kDa due to glycosylation
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
GLCNE (GNE) (NM_001128227) Human Tagged ORF Clone Lentiviral Particle
Krt20 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
NEK6 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
Rapsn sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)