Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Human (HEK293, His)

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-human-hek293-his.html

Purity

95.00

Smiles

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

7102 (Gene_ID) AAH18036.1 (R113-M213) (Accession)

Molecular Weight

Approximately 21-30 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Phospholipase B-like 1 (Plbd1)
MBS1436683-01 0.02 mg (E-Coli)

Recombinant Rat Phospholipase B-like 1 (Plbd1)

Sign In for Pricing
View Details
Recombinant Rat Phospholipase B-like 1 (Plbd1)
MBS1436683-02 0.02 mg (Yeast)

Recombinant Rat Phospholipase B-like 1 (Plbd1)

Sign In for Pricing
View Details
Recombinant Rat Phospholipase B-like 1 (Plbd1)
MBS1436683-03 0.1 mg (E-Coli)

Recombinant Rat Phospholipase B-like 1 (Plbd1)

Sign In for Pricing
View Details
Recombinant Rat Phospholipase B-like 1 (Plbd1)
MBS1436683-04 0.1 mg (Yeast)

Recombinant Rat Phospholipase B-like 1 (Plbd1)

Sign In for Pricing
View Details
Recombinant Rat Phospholipase B-like 1 (Plbd1)
MBS1436683-05 0.02 mg (Baculovirus)

Recombinant Rat Phospholipase B-like 1 (Plbd1)

Sign In for Pricing
View Details
Recombinant Rat Phospholipase B-like 1 (Plbd1)
MBS1436683-06 0.02 mg (Mammalian-Cell)

Recombinant Rat Phospholipase B-like 1 (Plbd1)

Sign In for Pricing
View Details