Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Human (HEK293, His)

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-human-hek293-his.html

Purity

95.00

Smiles

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

7102 (Gene_ID) AAH18036.1 (R113-M213) (Accession)

Molecular Weight

Approximately 21-30 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C12orf69 Protein Vector (Human) (pPB-His-GST)
PV328671 500 ng

C12orf69 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
CBL (NM_005188) Human Recombinant Protein
PH36217M5 20 µg

CBL (NM_005188) Human Recombinant Protein

Sign In for Pricing
View Details
ZNF678, CT (ZNF678, Zinc finger protein 678) (MaxLight 650) discontinued
044330-ML650 100 µL

ZNF678, CT (ZNF678, Zinc finger protein 678) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Afabicin 25mg
A19501-25 25 mg

Afabicin 25mg

Sign In for Pricing
View Details
Bioconjugated Fluorescent Nanodiamond with Biotin
NDNV100nmHibiotin2mg 2 mg

Bioconjugated Fluorescent Nanodiamond with Biotin

Sign In for Pricing
View Details
Beclin 2 Antibody
MBS809382-01 0.1 mg

Beclin 2 Antibody

Sign In for Pricing
View Details