Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Human (HEK293, His)

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-human-hek293-his.html

Purity

95.00

Smiles

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

7102 (Gene_ID) AAH18036.1 (R113-M213) (Accession)

Molecular Weight

Approximately 21-30 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-Cytokeratin 8
YF-PA12881 100 ug

anti-Cytokeratin 8

Sign In for Pricing
View Details
C4a (NM_011413) Mouse Tagged ORF Clone
MR215154 10 µg

C4a (NM_011413) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Serpina1f Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
43446066 1.0 µg DNA

Serpina1f Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) (NM_018677) Human Tagged Lenti ORF Clone
RC204260L4 10 µg

Acetyl CoA synthetase (ACSS2) (NM_018677) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human KMT2E Knockout HEK293T cell line
GTR15410549 1 Vial

Human KMT2E Knockout HEK293T cell line

Sign In for Pricing
View Details
Tryptase (TPS)
142651 200 µL

Tryptase (TPS)

Sign In for Pricing
View Details