Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Human (HEK293, His)

TM4SF2/TSPAN7 Protein is a member of the tetraspanin family. It mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. TSPAN7 promotes apoptosis and inhibits tumor growth and cell cycle progression in BCa via the regulation of multiple key components of the PTEN/PI3K/AKT pathway. During cell differentiation, TSPAN7 emerges as a master regulator of morphological changes through cytoskeletal remodeling. TM4SF2/TSPAN7 Protein, Human (HEK293, His) is the recombinant human-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-human-hek293-his.html

Purity

95.00

Smiles

RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

7102 (Gene_ID) AAH18036.1 (R113-M213) (Accession)

Molecular Weight

Approximately 21-30 kDa due to glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Yorkie homolog (YAP1) Rat ELISA Kit
I2996 96 Tests

Yorkie homolog (YAP1) Rat ELISA Kit

Sign In for Pricing
View Details
Human Fibronectin (FN) Antibody
11341-05011 150 µg

Human Fibronectin (FN) Antibody

Sign In for Pricing
View Details
Rabbit anti-PRAF2 Antibody
YLD6391-01 50 µL

Rabbit anti-PRAF2 Antibody

Sign In for Pricing
View Details
Rabbit anti-PRAF2 Antibody
YLD6391-02 100 µL

Rabbit anti-PRAF2 Antibody

Sign In for Pricing
View Details
Human hsa-miR-4530 miRNA Antagomir
abx886606-01 10 nmol

Human hsa-miR-4530 miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-4530 miRNA Antagomir
abx886606-02 20 nmol

Human hsa-miR-4530 miRNA Antagomir

Sign In for Pricing
View Details