Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aspidelaps scutatus Cytotoxin homolog S3C2

Product Specifications

Abbreviation

Recombinant Aspidelaps scutatus Cytotoxin homolog S3C2 protein

UniProt

P19003

Expression Region

1-63aa

Organism

Aspidelaps scutatus (Shield-nose snake)

Target Sequence

RKCLNTPLPLFYKTCPEGKDLCYKMNFKLLPKKLSIKRGCTDTCPKSSLLVKVVCCDTDKCNK

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

14.6 kDa

References & Citations

"Cannabinoid receptor CB2 localisation and agonist-mediated inhibition of capsaicin responses in human sensory neurons." Anand U., Otto W.R., Sanchez-Herrera D., Facer P., Yiangou Y., Korchev Y., Birch R., Benham C., Bountra C., Chessell I.P., Anand P. Pain 138:667-680 (2008)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Acetylornithine deacetylase (argE)
MBS1146913-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acetylornithine deacetylase (argE)
MBS1146913-02 0.02 mg (Yeast)

Recombinant Escherichia coli Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acetylornithine deacetylase (argE)
MBS1146913-03 0.1 mg (E-Coli)

Recombinant Escherichia coli Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acetylornithine deacetylase (argE)
MBS1146913-04 0.1 mg (Yeast)

Recombinant Escherichia coli Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acetylornithine deacetylase (argE)
MBS1146913-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details
Recombinant Escherichia coli Acetylornithine deacetylase (argE)
MBS1146913-06 0.02 mg (Mammalian-Cell)

Recombinant Escherichia coli Acetylornithine deacetylase (argE)

Sign In for Pricing
View Details