Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Complement component C8 gamma chain (C8G)

Product Specifications

Abbreviation

Recombinant Human C8G protein

Gene Name

C8G

UniProt

P07360

Expression Region

21-202aa

Organism

Homo sapiens (Human)

Target Sequence

QKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR

Tag

N-terminal 10xHis-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Immunology

Relevance

C8 is a constituent of the membrane attack complex. C8 binds to the C5B-7 complex, forming the C5B-8 complex. C5-B8 binds C9 and acts as a catalyst in the polymerization of C9. The gamma subunit seems to be able to bind retinol.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.9 kDa

References & Citations

"The homology of complement factor C8 gamma chain and alpha-1-microglobulin." Hunt L.T., Elzanowski A., Barker W.C. Biochem. Biophys. Res. Commun. 149:282-288 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Transforming growth factor α (TGFα) ELISA Kit
AE17171RB-01 48 Tests

Rabbit Transforming growth factor α (TGFα) ELISA Kit

Sign In for Pricing
View Details
Rabbit Transforming growth factor α (TGFα) ELISA Kit
AE17171RB-02 96 Tests

Rabbit Transforming growth factor α (TGFα) ELISA Kit

Sign In for Pricing
View Details
True North Cool Container
1211791 1 Unit

True North Cool Container

Sign In for Pricing
View Details
GOLGA3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2524402 100 µL

GOLGA3 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Dcun1d1 ORF Vector (Rat) (pORF)
ORF065837 1.0 µg DNA

Dcun1d1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Recombinant Human NCSTN, N-His
ARO-P13213-01 50 µg

Recombinant Human NCSTN, N-His

Sign In for Pricing
View Details