Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT

Product Specifications

Product Name Alternative

Bj-alpha-IT

Abbreviation

Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT protein

UniProt

Q56TT9

Expression Region

20-83aa

Organism

Hottentotta judaicus (Black scorpion) (Buthotus judaicus)

Target Sequence

GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Others

Relevance

Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

10.8 kDa

References & Citations

"BjalphaIT: a novel scorpion alpha-toxin selective for insects -- unique pharmacological tool." Arnon T., Potikha T., Sher D., Elazar M., Mao W., Tal T., Bosmans F., Tytgat J., Ben-Arie N., Zlotkin E. Insect Biochem. Mol. Biol. 35:187-195 (2005)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MICB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1301807 1.0 µg DNA

MICB sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral mouse Trpc1 shRNA (UAS) - Lentiviral mouse Trpc1 shRNA (UAS, iRFP) (100)
GTR15216483 1 Vial

Lentiviral mouse Trpc1 shRNA (UAS) - Lentiviral mouse Trpc1 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
CD320 Antibody
ABD8910 100 µg

CD320 Antibody

Sign In for Pricing
View Details
LINS1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV812312 1.0 µg DNA

LINS1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
USP20, ID (USP20, KIAA1003, LSFR3A, VDU2, Ubiquitin carboxyl-terminal hydrolase 20, Deubiquitinating enzyme 20, Ubiquitin thioesterase 20, Ubiquitin-specific-processing protease 20, VHL-interacting deubiquitinating enzyme 2) (MaxLight 750)
MBS6361892-01 0.1 mL

USP20, ID (USP20, KIAA1003, LSFR3A, VDU2, Ubiquitin carboxyl-terminal hydrolase 20, Deubiquitinating enzyme 20, Ubiquitin thioesterase 20, Ubiquitin-specific-processing protease 20, VHL-interacting deubiquitinating enzyme 2) (MaxLight 750)

Sign In for Pricing
View Details
USP20, ID (USP20, KIAA1003, LSFR3A, VDU2, Ubiquitin carboxyl-terminal hydrolase 20, Deubiquitinating enzyme 20, Ubiquitin thioesterase 20, Ubiquitin-specific-processing protease 20, VHL-interacting deubiquitinating enzyme 2) (MaxLight 750)
MBS6361892-02 5x 0.1 mL

USP20, ID (USP20, KIAA1003, LSFR3A, VDU2, Ubiquitin carboxyl-terminal hydrolase 20, Deubiquitinating enzyme 20, Ubiquitin thioesterase 20, Ubiquitin-specific-processing protease 20, VHL-interacting deubiquitinating enzyme 2) (MaxLight 750)

Sign In for Pricing
View Details