Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tmem185a Pre-designed siRNA Set B
SI214746B 1 Each

Rat Tmem185a Pre-designed siRNA Set B

Sign In for Pricing
View Details
Mouse Krtap1-5 (NM_027157) AAV Particle
MR214784A1V 250 µL

Mouse Krtap1-5 (NM_027157) AAV Particle

Sign In for Pricing
View Details
REC-1/STAT3 Reporter (Luc) stable cell line
GTR15424109 1 Vial

REC-1/STAT3 Reporter (Luc) stable cell line

Sign In for Pricing
View Details
EDG-1 (T48) polyclonal antibody
BS2593-01 50 µL

EDG-1 (T48) polyclonal antibody

Sign In for Pricing
View Details
EDG-1 (T48) polyclonal antibody
BS2593-02 100 µL

EDG-1 (T48) polyclonal antibody

Sign In for Pricing
View Details
Dtx3l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4907208 1.0 µg DNA

Dtx3l sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details