Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calmodulin-1 (CALM1) Antibody Pair
abx117304 5x 96 Tests

Calmodulin-1 (CALM1) Antibody Pair

Sign In for Pricing
View Details
Rabbit Polyclonal SF3A3 Antibody
NBP1-57424 100 µL

Rabbit Polyclonal SF3A3 Antibody

Sign In for Pricing
View Details
Mouse Mfsd8 (NM_028140) AAV Particle
MR224019A1V 250 µL

Mouse Mfsd8 (NM_028140) AAV Particle

Sign In for Pricing
View Details
C2cd2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6398907 1.0 µg DNA

C2cd2l sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Canine Distemper/Adeno Ag Combo Test
109140-01 10 Tests

Canine Distemper/Adeno Ag Combo Test

Sign In for Pricing
View Details
Canine Distemper/Adeno Ag Combo Test
109140-02 20 Tests

Canine Distemper/Adeno Ag Combo Test

Sign In for Pricing
View Details