Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCT Rabbit pAb
A6287 20 µL

DCT Rabbit pAb

Sign In for Pricing
View Details
Mouse Gamma-crystallin E, Cryge ELISA KIT
ELI-10114m 96 Tests

Mouse Gamma-crystallin E, Cryge ELISA KIT

Sign In for Pricing
View Details
Gynosaponin TN2
MF-0124959-01 10 mg

Gynosaponin TN2

Sign In for Pricing
View Details
Gynosaponin TN2
MF-0124959-02 50 mg

Gynosaponin TN2

Sign In for Pricing
View Details
Chromogranin A (CHGA) (NM_001275) Human 3' UTR Clone
SC205997 10 µg

Chromogranin A (CHGA) (NM_001275) Human 3' UTR Clone

Sign In for Pricing
View Details
TMEM101 Antibody
MBS9606194-01 0.1 mL

TMEM101 Antibody

Sign In for Pricing
View Details