Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ATF7IP antibody
STJ116407 100 µl

Anti-ATF7IP antibody

Sign In for Pricing
View Details
Lentiviral mouse Ndufa13 shRNA (UAS) - Lentiviral mouse Ndufa13 shRNA (UAS) (25)
GTR15185957 1 Vial

Lentiviral mouse Ndufa13 shRNA (UAS) - Lentiviral mouse Ndufa13 shRNA (UAS) (25)

Sign In for Pricing
View Details
Histone H2B discontinued
343756-01 100 µL

Histone H2B discontinued

Sign In for Pricing
View Details
Histone H2B discontinued
343756-02 200 µL

Histone H2B discontinued

Sign In for Pricing
View Details
DDX19A Human shRNA Lentiviral Particle (Locus ID 55308)
TL305071V 500 µL Each

DDX19A Human shRNA Lentiviral Particle (Locus ID 55308)

Sign In for Pricing
View Details
Recombinant Chicken 14-3-3 protein theta (YWHAQ)
MBS1424541-01 0.02 mg (E-Coli)

Recombinant Chicken 14-3-3 protein theta (YWHAQ)

Sign In for Pricing
View Details