Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OVOL1 Antibody
MBS8587153-01 0.1 mg

OVOL1 Antibody

Sign In for Pricing
View Details
OVOL1 Antibody
MBS8587153-02 0.1 mL (AF405L)

OVOL1 Antibody

Sign In for Pricing
View Details
OVOL1 Antibody
MBS8587153-03 0.1 mL (AF405S)

OVOL1 Antibody

Sign In for Pricing
View Details
OVOL1 Antibody
MBS8587153-04 0.1 mL (AF610)

OVOL1 Antibody

Sign In for Pricing
View Details
OVOL1 Antibody
MBS8587153-05 0.1 mL (AF635)

OVOL1 Antibody

Sign In for Pricing
View Details
OVOL1 Antibody
MBS8587153-06 0.1 mL (APC)

OVOL1 Antibody

Sign In for Pricing
View Details