Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human OSMR shRNA (UAS) - Lentiviral human OSMR shRNA (UAS, RFP) (100)
GTR15142056 1 Vial

Lentiviral human OSMR shRNA (UAS) - Lentiviral human OSMR shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
PSB7 rabbit pAb
ES18916-01 50 µL

PSB7 rabbit pAb

Sign In for Pricing
View Details
PSB7 rabbit pAb
ES18916-02 100 µL

PSB7 rabbit pAb

Sign In for Pricing
View Details
Rergl ORF Vector (Rat) (pORF)
ORF074701 1.0 µg DNA

Rergl ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
LAX1 Peptide - C-terminal region
MBS3239135-01 0.1 mg

LAX1 Peptide - C-terminal region

Sign In for Pricing
View Details
LAX1 Peptide - C-terminal region
MBS3239135-02 5x 0.1 mg

LAX1 Peptide - C-terminal region

Sign In for Pricing
View Details