Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

E2 230K (UBE2O) Rabbit Polyclonal Antibody
TA383024 100 µL

E2 230K (UBE2O) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Olfr609 (NM_147082) Mouse Tagged ORF Clone
MG214887 10 µg

Olfr609 (NM_147082) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
APBB1 Polyclonal Antibody
RA31127-01 50 µL

APBB1 Polyclonal Antibody

Sign In for Pricing
View Details
APBB1 Polyclonal Antibody
RA31127-02 100 µL

APBB1 Polyclonal Antibody

Sign In for Pricing
View Details
DKW Group III Mesonutrient Solution, 10x
B2023234 1 L

DKW Group III Mesonutrient Solution, 10x

Sign In for Pricing
View Details
Growth Differentiation Factor 1 (GDF1) Mouse ELISA Kit
D6510 96 Tests

Growth Differentiation Factor 1 (GDF1) Mouse ELISA Kit

Sign In for Pricing
View Details