Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM4SF2/TSPAN7, Rat (HEK293, His)

TM4SF2/TSPAN7 protein is a highly expressed tetraspanin that is involved in synaptic transmission, neuronal morphogenesis, DCs, and osteoblast morphogenesis. Additionally, it plays a key role in tumorigenesis, promotion, and metastasis. TM4SF2/TSPAN7 Protein, Rat (HEK293, His) is the recombinant rat-derived TM4SF2/TSPAN7 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

TM4SF2/TSPAN7 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tm4sf2-tspan7-protein-rat-hek293-his.html

Purity

95.70

Smiles

RHEIKDTFLRTYTDAMQNYNGKDERSRAVDHVQRSLSCCGVQNYTNWSSSPYFLEHGIPPSCCMNETDCNPLDLHNLTVAATKVNQKGCYDLVTSFMETNM

Molecular Formula

363447 (Gene_ID) ABX10436 (R108-M208) (Accession)

Molecular Weight

Approximately 18-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC10A1 siRNA (Human)
MBS8205230-01 15 nmol

SLC10A1 siRNA (Human)

Sign In for Pricing
View Details
SLC10A1 siRNA (Human)
MBS8205230-02 30 nmol

SLC10A1 siRNA (Human)

Sign In for Pricing
View Details
SLC10A1 siRNA (Human)
MBS8205230-03 5x 30 nmol

SLC10A1 siRNA (Human)

Sign In for Pricing
View Details
Lumipulse® G β-Amyloid 1-42 Calibrators
230343 2x 3 Concentrations

Lumipulse® G β-Amyloid 1-42 Calibrators

Sign In for Pricing
View Details
MLXIPL (Carbohydrate-responsive Element-binding Protein, MLX Interacting Protein-like)
485917 100 µL

MLXIPL (Carbohydrate-responsive Element-binding Protein, MLX Interacting Protein-like)

Sign In for Pricing
View Details
Amhr2 (NM_030998) Rat Tagged Lenti ORF Clone
RR204670L4 10 µg

Amhr2 (NM_030998) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details