Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBL2/COLEC1, Mouse (HEK293)

C-type lectin domain-containing protein is a soluble mannose-binding protein in serum which belongs to the collectin family and is an important element in the innate immune system. C-type lectin domain-containing protein exerts mannose-binding, calcium-dependent protein binding and identical protein binding activity. MBL2/COLEC1 Protein, Mouse (HEK293) is the recombinant mouse-derived MBL2/COLEC1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

MBL2/COLEC1 Protein, Mouse (HEK293), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mbl-2-protein-mouse-hek-293.html

Purity

95.00

Smiles

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Molecular Formula

17195 (Gene_ID) Q3UEK1 (E19-D244) (Accession)

Molecular Weight

Approximately 27.0-30.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MITD1 Rabbit Polyclonal Antibody
TA378537 100 µL

MITD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KLK1C7 Adenovirus (Rat)
60924056 1.0 mL

KLK1C7 Adenovirus (Rat)

Sign In for Pricing
View Details
Tert-Butyl 4-amino-3-methoxybenzoate
YEA33092-01 100 mg

Tert-Butyl 4-amino-3-methoxybenzoate

Sign In for Pricing
View Details
Tert-Butyl 4-amino-3-methoxybenzoate
YEA33092-02 1 g

Tert-Butyl 4-amino-3-methoxybenzoate

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae ATP synthase gamma chain (atpG)
MBS1159933-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae ATP synthase gamma chain (atpG)
MBS1159933-02 0.02 mg (Yeast)

Recombinant Haemophilus influenzae ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details