Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A11, Human (Cell-Free, His)

The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC7A11 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc7a11-protein-human-cf-his.html

Purity

96.00

Smiles

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Molecular Formula

23657 (Gene_ID) Q9UPY5 (M1-L501) (Accession)

Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Escherichia coli Uncharacterized protein ydcX (ydcX) , partial
MBS1089643-01 1 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized protein ydcX (ydcX) , partial

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized protein ydcX (ydcX) , partial
MBS1089643-02 1 mg (Yeast)

Recombinant Escherichia coli Uncharacterized protein ydcX (ydcX) , partial

Sign In for Pricing
View Details
APOBEC3A_B Rabbit Polyclonal Antibody
TA357902 100 µL

APOBEC3A_B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Enpp4 3'UTR GFP Stable Cell Line
TU253992 1.0 mL

Enpp4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Creb3l3 (NM_001012115) Rat Tagged ORF Clone Lentiviral Particle
RR209683L4V 200 µL

Creb3l3 (NM_001012115) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Recombinant Human K48-Ub3 protein
RP10143LQ 25 µg

Recombinant Human K48-Ub3 protein

Sign In for Pricing
View Details