Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A11, Human (Cell-Free, His)

The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC7A11 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc7a11-protein-human-cf-his.html

Purity

96.00

Smiles

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Molecular Formula

23657 (Gene_ID) Q9UPY5 (M1-L501) (Accession)

Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Liver Type Fatty Acid Binding Protein L-FABP GENLISA ELISA
KLM1502 96 Well

Mouse Liver Type Fatty Acid Binding Protein L-FABP GENLISA ELISA

Sign In for Pricing
View Details
C14orf100 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV813985 1.0 µg DNA

C14orf100 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
MAP3K21 Knockout HCT116 Polyclonal Cells
ARG7075 1 Million

MAP3K21 Knockout HCT116 Polyclonal Cells

Sign In for Pricing
View Details
HPLC Column, C18-Aqueous,5μm,120Å,2.1x75mm
13011040 1 PC

HPLC Column, C18-Aqueous,5μm,120Å,2.1x75mm

Sign In for Pricing
View Details
C15orf40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0307908 1.0 µg DNA

C15orf40 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
NRIP2 Recombinant Protein (Mouse)
RP155030 100 µg

NRIP2 Recombinant Protein (Mouse)

Sign In for Pricing
View Details