Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A11, Human (Cell-Free, His)

The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC7A11 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc7a11-protein-human-cf-his.html

Purity

96.00

Smiles

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Molecular Formula

23657 (Gene_ID) Q9UPY5 (M1-L501) (Accession)

Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC283788 Human shRNA Lentiviral Particle (Locus ID 283788)
TL318233V 500 µL Each

LOC283788 Human shRNA Lentiviral Particle (Locus ID 283788)

Sign In for Pricing
View Details
Akr1b8 Protein Vector (Mouse) (pPB-C-His)
PV153618 500 ng

Akr1b8 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Goat 3 Alpha-Androstanediol (3A-Diol) ELISA Kit
MBS9908016 Inquire

Goat 3 Alpha-Androstanediol (3A-Diol) ELISA Kit

Sign In for Pricing
View Details
KRT8P44 Recombinant Protein (Human)
RP067470 100 µg

KRT8P44 Recombinant Protein (Human)

Sign In for Pricing
View Details
Anti-NR4A2 Antibody
STJ501990 100 µg

Anti-NR4A2 Antibody

Sign In for Pricing
View Details
Rabbit anti-Drosophila melanogaster (Fruit fly) rho Polyclonal Antibody
MBS7152969 Inquire

Rabbit anti-Drosophila melanogaster (Fruit fly) rho Polyclonal Antibody

Sign In for Pricing
View Details