Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A11, Human (Cell-Free, His)

The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC7A11 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc7a11-protein-human-cf-his.html

Purity

96.00

Smiles

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Molecular Formula

23657 (Gene_ID) Q9UPY5 (M1-L501) (Accession)

Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDO2 / INDOL1 Polyclonal Antibody
ANT-12655-50ug 50 µg

IDO2 / INDOL1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-PRKACA antibody
SL7479R-01 50 µL

Rabbit Anti-PRKACA antibody

Sign In for Pricing
View Details
Rabbit Anti-PRKACA antibody
SL7479R-02 100 µL

Rabbit Anti-PRKACA antibody

Sign In for Pricing
View Details
Recombinant Human CAIII Protein, His, E.coli-5ug
QP11256-5ug 5ug

Recombinant Human CAIII Protein, His, E.coli-5ug

Sign In for Pricing
View Details
CDK2AP1 (A-9) P
sc-515036 P 100 µg - 0.5 mL

CDK2AP1 (A-9) P

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial
MBS7087664 Inquire

Recombinant Prochlorococcus marinus Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY), partial

Sign In for Pricing
View Details