Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC7A11, Human (Cell-Free, His)

The SLC7A11 protein forms a heterodimer with SLC3A2 and acts as an antiporter to exchange extracellular L-cystine for intracellular L-glutamate across the plasma membrane. This sodium-independent electroneutral transport, with a 1:1 stoichiometry, relies on high intracellular levels of L-glutamate and intracellular reduction of L-cystine. SLC7A11 Protein, Human (Cell-Free, His) is the recombinant human-derived SLC7A11 protein, expressed by E. coli Cell-free , with N-10*His labeled tag.

Product Specifications

Product Name Alternative

SLC7A11 Protein, Human (Cell-Free, His), Human, E. coli Cell-free

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/slc7a11-protein-human-cf-his.html

Purity

96.00

Smiles

MVRKPVVSTISKGGYLQGNVNGRLPSLGNKEPPGQEKVQLKRKVTLLRGVSIIIGTIIGAGIFISPKGVLQNTGSVGMSLTIWTVCGVLSLFGALSYAELGTTIKKSGGHYTYILEVFGPLPAFVRVWVELLIIRPAATAVISLAFGRYILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWFYLNFVTEEVENPEKTIPLAICISMAIVTIGYVLTNVAYFTTINAEELLLSNAVAVTFSERLLGNFSLAVPIFVALSCFGSMNGGVFAVSRLFYVASREGHLPEILSMIHVRKHTPLPAVIVLHPLTMIMLFSGDLDSLLNFLSFARWLFIGLAVAGLIYLRYKCPDMHRPFKVPLFIPALFSFTCLFMVALSLYSDPFSTGIGFVITLTGVPAYYLFIIWDKKPRWFRIMSEKITRTLQIILEVVPEEDKL

Molecular Formula

23657 (Gene_ID) Q9UPY5 (M1-L501) (Accession)

Molecular Weight

Approximately 58 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cinaciguat hydrochloride 25mg
A21838-25 25 mg

Cinaciguat hydrochloride 25mg

Sign In for Pricing
View Details
Nori Bovine CCL2/MCP-1 ELISA Kit-Synovial Fluid
GR112062-SF 96 Well

Nori Bovine CCL2/MCP-1 ELISA Kit-Synovial Fluid

Sign In for Pricing
View Details
RAB37 Protein Vector (Mouse) (pPM-C-HA)
PV221720 500 ng

RAB37 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Tgfb2 (NM_009367) Mouse Tagged ORF Clone Lentiviral Particle
MR225633L3V 200 µL

Tgfb2 (NM_009367) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
F-Spondin Lentiviral Activation Particles (m)
sc-433292-LAC 200 µL

F-Spondin Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
NUP50, ID (NUP50, NPAP60L, Nuclear pore complex protein Nup50, 50kD nucleoporin, Nuclear pore-associated protein 60kD-like, Nucleoporin Nup50) (FITC) discontinued
039221-FITC 200 µL

NUP50, ID (NUP50, NPAP60L, Nuclear pore complex protein Nup50, 50kD nucleoporin, Nuclear pore-associated protein 60kD-like, Nucleoporin Nup50) (FITC) discontinued

Sign In for Pricing
View Details