Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Murinoglobulin-1/Mug1, Mouse (His)

Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Murinoglobulin-1/Mug1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/murinoglobulin-1-mug1-protein-mouse-his.html

Purity

95.00

Smiles

TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE

Molecular Formula

17836 (Gene_ID) P28665 (T700-E910) (Accession)

Molecular Weight

Approximately 32.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse CD45 (Protein Tyrosine Phosphatase Receptor Type C) ELISA Kit
EM23669 96 Tests

Mouse CD45 (Protein Tyrosine Phosphatase Receptor Type C) ELISA Kit

Ask
View Details
Anti-C5 (crovalimab biosimilar) mAb
12-90107-50 50 µg

Anti-C5 (crovalimab biosimilar) mAb

Ask
View Details
NFYA Human shRNA Plasmid Kit (Locus ID 4800)
TR311182 1 Kit

NFYA Human shRNA Plasmid Kit (Locus ID 4800)

Ask
View Details
Xpress™ Human APOBEC3C Over-expressing Stable Cell Line
ABC-X0178 1 Vial

Xpress™ Human APOBEC3C Over-expressing Stable Cell Line

Ask
View Details
CYP1A2, ID (CYP1A2, Cytochrome P450 1A2, CYPIA2, Cytochrome P(3)450, Cytochrome P450 4, Cytochrome P450-P3) (MaxLight 550)
MBS6290415-01 0.1 mL

CYP1A2, ID (CYP1A2, Cytochrome P450 1A2, CYPIA2, Cytochrome P(3)450, Cytochrome P450 4, Cytochrome P450-P3) (MaxLight 550)

Ask
View Details
CYP1A2, ID (CYP1A2, Cytochrome P450 1A2, CYPIA2, Cytochrome P(3)450, Cytochrome P450 4, Cytochrome P450-P3) (MaxLight 550)
MBS6290415-02 5x 0.1 mL

CYP1A2, ID (CYP1A2, Cytochrome P450 1A2, CYPIA2, Cytochrome P(3)450, Cytochrome P450 4, Cytochrome P450-P3) (MaxLight 550)

Ask
View Details