Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Murinoglobulin-1/Mug1, Mouse (His)

Murinoglobulin-1 (Mug1) protein is a protease inhibitor that undergoes specific proteolytic activation, triggers conformational changes, and traps or covalently binds proteases.In the tetrameric form, steric hindrance alone provides strong inhibition.Murinoglobulin-1/Mug1 Protein, Mouse (His) is the recombinant mouse-derived Murinoglobulin-1/Mug1 protein, expressed by E.coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

Murinoglobulin-1/Mug1 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/murinoglobulin-1-mug1-protein-mouse-his.html

Purity

95.00

Smiles

TPEISWSLRTTLSKRPEEPPRKDPSSNDPLTETIRKYFPETWVWDIVTVNSTGLAEVEMTVPDTITEWKAGALCLSNDTGLGLSSVVPLQAFKPFFVEVSLPYSVVRGEAFMLKATVMNYLPTSMQMSVQLEASPDFTAVPVGDDQDSYCLSANGRHTSSWLVTPKSLGNVNFSVSAEAQQSSEPCGSEVATVPETGRKDTVVKVLIVEPE

Molecular Formula

17836 (Gene_ID) P28665 (T700-E910) (Accession)

Molecular Weight

Approximately 32.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
BNC051429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF405S conjugate, 0.1mg/mL
BNC040338-500 1x 500 µL

P53 (PAb122), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2910), CF740 conjugate, 0.1mg/mL
BNC742910-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2910), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL
BNC941813-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL
BNUB0806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), 0.2mg/mL

Sign In for Pricing
View Details
PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL
BNC471091-100 1x 100 µL

PS2 (TFF1/1091), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details