Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interleukin-12 receptor subunit beta-2 (IL12RB2), partial

Product Specifications

Product Name Alternative

IL-12 receptor subunit beta-2; IL-12R subunit beta-2; IL-12R-beta-2; IL-12RB2

Abbreviation

Recombinant Human IL12RB2 protein, partial

Gene Name

IL12RB2

UniProt

Q99665

Expression Region

24-317aa

Organism

Homo sapiens (Human)

Target Sequence

KIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLNRLRYRPSNSRLWNMVNVTKAKGRHDLLDLKPFTEYEFQISSKLHLYKGSWSDWSESLRAQTP

Tag

C-terminal 10xHis-tagged

Type

Developed Protein

Source

Baculovirus

Field of Research

Cancer

Relevance

Receptor for interleukin-12. This subunit is the signaling component coupling to the JAK2/STAT4 pathway. Promotes the proliferation of T-cells as well as NK cells. Induces the promotion of T-cells towards the Th1 phenotype by strongly enhancing IFN-gamma production.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

35.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CABP5 Antibody [DyLight 594]
NBP3-06122DL594 0.1 mL

Rabbit Polyclonal CABP5 Antibody [DyLight 594]

Sign In for Pricing
View Details
Mouse Polyclonal beta-Glucuronidase/GUSB Antibody
H00002990-B01P 0.05 mg

Mouse Polyclonal beta-Glucuronidase/GUSB Antibody

Sign In for Pricing
View Details
Canine S Antigen ELISA Kit
MBS008900-01 48 Well

Canine S Antigen ELISA Kit

Sign In for Pricing
View Details
Canine S Antigen ELISA Kit
MBS008900-02 96 Well

Canine S Antigen ELISA Kit

Sign In for Pricing
View Details
Canine S Antigen ELISA Kit
MBS008900-03 5x 96 Well

Canine S Antigen ELISA Kit

Sign In for Pricing
View Details
Canine S Antigen ELISA Kit
MBS008900-04 10x 96 Well

Canine S Antigen ELISA Kit

Sign In for Pricing
View Details