Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

Product Specifications

Product Name Alternative

Serpin A1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a1-protein-human-hek293-his.html

Purity

98.0

Smiles

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Formula

5265 (Gene_ID) AAH11991.1 (E25-K418) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12 (7) :827-35.|[2]Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6 (4) :345-349.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHD Antibody
F41948-0.08ML 0.08 mL

SDHD Antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) ASTB Polyclonal Antibody
MBS7172992 Inquire

Rabbit anti-Escherichia fergusonii (strain 35469/DSM 13698/CDC 0568-73) ASTB Polyclonal Antibody

Sign In for Pricing
View Details
MSK1 (RPS6KA5) (NM_004755) Human Tagged ORF Clone
RC220636 10 µg

MSK1 (RPS6KA5) (NM_004755) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human CRIP1 ELISA Kit (Colorimetric)
NBP3-27440 1 Kit

Human CRIP1 ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
Cib2 (NM_019686) Mouse Untagged Clone
MC200563 10 µg

Cib2 (NM_019686) Mouse Untagged Clone

Sign In for Pricing
View Details
Hydrogen exchanger 3 Polyclonal Antibody, FITC Conjugated
bs-8601R-FITC 100 µL

Hydrogen exchanger 3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details