Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A1, Human (HEK293, His)

Serpin A1 Protein, Human (HEK293, His) produced in HEK293 cells is a mouse recombinant Serpin A1a with a His tag at the C-terminus[1]. Alpha-1 Antitrypsin Exerts a hepatoprotective effect on immune-mediated hepatitis and acetaminophen-induced liver injury[2].

Product Specifications

Product Name Alternative

Serpin A1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a1-protein-human-hek293-his.html

Purity

98.0

Smiles

EDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQVTTVKVPMMKRLGMFNIQHCKKLSSWVLLMKYLGNATAIFFLPDEGKLQHLENELTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGADLSGVTEEAPLKLSKAVHKAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQKHHHHHH

Molecular Formula

5265 (Gene_ID) AAH11991.1 (E25-K418) (Accession)

Molecular Weight

50-65 kDa

References & Citations

[1]Hunt JM, et al. Alpha 1 anti-trypsin: one protein, many functions. Curr Mol Med. 2012 Aug;12 (7) :827-35.|[2]Yehudit Shabat, et al. Alpha-1 Anti-trypsin Exerts a Hepatoprotective Effect on Immune-mediated Hepatitis and Acetaminophen-induced Liver Injury. J Clin Transl Hepatol. 2018 Dec 28;6 (4) :345-349.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified anti-GAPDH Antibody, 200 μg
NA001911200 200 µg

Purified anti-GAPDH Antibody, 200 μg

Sign In for Pricing
View Details
P53 (Acetyl Lys370) Rabbit Polyclonal Antibody
E28PK0035 100 µL

P53 (Acetyl Lys370) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Annexin A3/ANXA3 Protein
PKSH032075-01 10 µg

Recombinant Human Annexin A3/ANXA3 Protein

Sign In for Pricing
View Details
Recombinant Human Annexin A3/ANXA3 Protein
PKSH032075-02 50 µg

Recombinant Human Annexin A3/ANXA3 Protein

Sign In for Pricing
View Details
CTNNA3 (Catenin alpha-3, Alpha T-catenin, Cadherin-associated Protein) (HRP)
125450-HRP 100 µL

CTNNA3 (Catenin alpha-3, Alpha T-catenin, Cadherin-associated Protein) (HRP)

Sign In for Pricing
View Details
ARHGAP23 Blocking Peptide
CBP7226-01 1 mg

ARHGAP23 Blocking Peptide

Sign In for Pricing
View Details