Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MID1IP1, Human (His)

Mid1-interacting protein 1 plays a role in the regulation of lipogenesis in liver and up-regulates ACACA enzyme activity. Mid1-interacting protein 1 required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Mid1-interacting protein 1 involved in stabilization of microtubules. MID1IP1 Protein, Human (His) is the recombinant human-derived MID1IP1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

MID1IP1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mid1ip1-protein-human-his.html

Purity

97.70

Smiles

MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

Molecular Formula

58526 (Gene_ID) Q9NPA3 (M1-H183) (Accession)

Molecular Weight

Approximately 25 kDa.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (AP)
MBS6373565-01 0.1 mL

CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (AP)

Sign In for Pricing
View Details
CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (AP)
MBS6373565-02 5x 0.1 mL

CDK7 (Cell Division Protein Kinase 7, CDK-activating Kinase, CAK, TFIIH Basal Transcription Factor Complex Kinase Subunit, 39kD Protein Kinase, P39 Mo15, STK1, CAK1, MO15) (AP)

Sign In for Pricing
View Details
Rat EPCR(Endothelial Protein C Receptor)ELISA Kit
MBS2514218-01 24 Tests

Rat EPCR(Endothelial Protein C Receptor)ELISA Kit

Sign In for Pricing
View Details
Rat EPCR(Endothelial Protein C Receptor)ELISA Kit
MBS2514218-02 48 Test

Rat EPCR(Endothelial Protein C Receptor)ELISA Kit

Sign In for Pricing
View Details
Rat EPCR(Endothelial Protein C Receptor)ELISA Kit
MBS2514218-03 96 Tests

Rat EPCR(Endothelial Protein C Receptor)ELISA Kit

Sign In for Pricing
View Details
Rat EPCR(Endothelial Protein C Receptor)ELISA Kit
MBS2514218-04 5x 96 Tests

Rat EPCR(Endothelial Protein C Receptor)ELISA Kit

Sign In for Pricing
View Details