Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TSLP, Human (HEK293, His-Myc)

TSLP Protein, a cytokine, stimulates T-cell-attracting chemokine release from monocytes and enhances CD11c (+) dendritic cell maturation. It directly activates mast cells, possibly inducing allergic inflammation. TSLP may also possess antimicrobial properties in the oral cavity and on the skin. TSLP Protein, Human (HEK293, His-Myc) is the recombinant human-derived TSLP protein, expressed by HEK293 , with N-Myc, N-6*His labeled tag.

Product Specifications

Product Name Alternative

TSLP Protein, Human (HEK293, His-Myc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/tslp-protein-human-hek293-his-myc.html

Purity

94

Smiles

YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Molecular Formula

85480 (Gene_ID) Q969D9-1 (Y29-Q159) (Accession)

Molecular Weight

Approximately 20&25&30 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Lewis Y Antibody (LWY/1463) [Janelia Fluor 549]
NBP2-54560JF549 0.1 mL

Mouse Monoclonal Lewis Y Antibody (LWY/1463) [Janelia Fluor 549]

Sign In for Pricing
View Details
PFKFB3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
SR303464 2 nmol

PFKFB3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Sign In for Pricing
View Details
LRRC15/LIB, His, Cynomolgus/Rhesus macaque
Z04952-100 100 µg

LRRC15/LIB, His, Cynomolgus/Rhesus macaque

Sign In for Pricing
View Details
RGP1 Lentiviral Activation Particles (h)
sc-411356-LAC 200 µL

RGP1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
ANKMY1 Lentiviral Activation Particles (m2)
sc-433816-LAC-2 200 µL

ANKMY1 Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Boc-NH-PEG8-OH
MD068002-8 1 g

Boc-NH-PEG8-OH

Sign In for Pricing
View Details