Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP-16, Human (I152N, His)

The MMP-16 protein functions as an endopeptidase capable of degrading various components of the extracellular matrix, particularly type III collagen and fibronectin. Its effects extend to the activation of progelatinase A, which contributes to the dynamic remodeling of the extracellular matrix within blood vessels. MMP-16 Protein, Human (I152N, His) is the recombinant human-derived MMP-16 protein, expressed by E. coli , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

MMP-16 Protein, Human (I152N, His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mmp-16-protein-human-i152n-his.html

Purity

97.00

Smiles

ATVCGTEQYFNVEVWLQKYGYLPPTDPRMSVLRSAETMQSALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYALTGQKWQHKHITYSIKNVTPKVGDPETRKANRRAFDVWQNVTPLTFEEVPYSELENGKRDVDITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFLVAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYG

Molecular Formula

4325 (Gene_ID) P51512 (A32-G291, I152N) (Accession)

Molecular Weight

Approximately 29 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRAMEF17 (NM_001099851) Human Tagged Lenti ORF Clone
RC225803L4 10 µg

PRAMEF17 (NM_001099851) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
N-Methyl Pantoprazole (Mixture of 1 and 3 isomers)
017244 5 mg

N-Methyl Pantoprazole (Mixture of 1 and 3 isomers)

Sign In for Pricing
View Details
Papolg sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4566803 1.0 µg DNA

Papolg sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
TRNAS22 CRISPR All-in-one AAV vector set (with saCas9)(Human)
48378151 3x 1.0 µg DNA

TRNAS22 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Goat L-Phenylalanine (LPA) ELISA Kit
MBS264092-01 48 Well

Goat L-Phenylalanine (LPA) ELISA Kit

Sign In for Pricing
View Details
Goat L-Phenylalanine (LPA) ELISA Kit
MBS264092-02 96 Well

Goat L-Phenylalanine (LPA) ELISA Kit

Sign In for Pricing
View Details