Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 beta, Human (HEK293, His)

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 beta Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8-beta-protein-human-hek-293-his.html

Purity

98.0

Smiles

LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Molecular Formula

926 (Gene_ID) P10966-1 (L22-P170) (Accession)

Molecular Weight

25-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Napg (NM_028017) Mouse Tagged ORF Clone
MR204429 10 µg

Napg (NM_028017) Mouse Tagged ORF Clone

Ask
View Details
Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit
MBS8820638-01 48 Well

Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit

Ask
View Details
Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit
MBS8820638-02 96 Well

Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit

Ask
View Details
Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit
MBS8820638-03 5x 96 Well

Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit

Ask
View Details
Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit
MBS8820638-04 10x 96 Well

Mouse PNPLA2 (Patatin Like Phospholipase Domain Containing Protein 2) ELISA Kit

Ask
View Details
anti-Blood Group Kell Antigen
YF-PA12828 50 ul

anti-Blood Group Kell Antigen

Ask
View Details