CD8 beta, Human (HEK293, His)
CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD8 beta Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd8-beta-protein-human-hek-293-his.html
Purity
98.0
Smiles
LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP
Molecular Formula
926 (Gene_ID) P10966-1 (L22-P170) (Accession)
Molecular Weight
25-32 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
NAPRT1 (Nicotinate Phosphoribosyltransferase, NAPRTase, FHA-HIT-interacting Protein, Nicotinate Phosphoribosyltransferase Domain-containing Protein 1, FHIP, PP3856) (MaxLight 650)
Lentiviral human PABPC5 sgRNA gene knockout kit - Lentiviral human PABPC5 sgRNA gene knockout kit (plasmid)
