Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 beta, Human (HEK293, His)

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 beta Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8-beta-protein-human-hek-293-his.html

Purity

98.0

Smiles

LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Molecular Formula

926 (Gene_ID) P10966-1 (L22-P170) (Accession)

Molecular Weight

25-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Fbxo6 (NM_015797) Mouse Tagged Lenti ORF Clone
MR219089L3 10 µg

Fbxo6 (NM_015797) Mouse Tagged Lenti ORF Clone

Ask
View Details
Thiosulfate Sulfurtransferase Like Domain Containing 1 Human Recombinant (TSTD1 Human)
PT_71987-01 2 µg

Thiosulfate Sulfurtransferase Like Domain Containing 1 Human Recombinant (TSTD1 Human)

Ask
View Details
Thiosulfate Sulfurtransferase Like Domain Containing 1 Human Recombinant (TSTD1 Human)
PT_71987-02 10 µg

Thiosulfate Sulfurtransferase Like Domain Containing 1 Human Recombinant (TSTD1 Human)

Ask
View Details
Thiosulfate Sulfurtransferase Like Domain Containing 1 Human Recombinant (TSTD1 Human)
PT_71987-03 1 mg

Thiosulfate Sulfurtransferase Like Domain Containing 1 Human Recombinant (TSTD1 Human)

Ask
View Details
NR1, phosphorylated (Ser896) (NMDA Receptor, N-methyl-D-aspartate Receptor) (HRP) discontinued
N5380-08-HRP 100 µL

NR1, phosphorylated (Ser896) (NMDA Receptor, N-methyl-D-aspartate Receptor) (HRP) discontinued

Ask
View Details
ZIP Kinase (DAPK3) Human shRNA Plasmid Kit (Locus ID 1613)
TR320321 1 Kit

ZIP Kinase (DAPK3) Human shRNA Plasmid Kit (Locus ID 1613)

Ask
View Details