Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD8 beta, Human (HEK293, His)

CD8 beta is an important immune glycoprotein that serves as a coreceptor for MHC class I:peptide complexes, linking T cells to antigens presented by APCs. It interacts with TCR and MHC class I, recruits LCK kinase, and initiates multiple signaling pathways. CD8 beta Protein, Human (HEK293, His) is the recombinant human-derived CD8 beta protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD8 beta Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd8-beta-protein-human-hek-293-his.html

Purity

98.0

Smiles

LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Molecular Formula

926 (Gene_ID) P10966-1 (L22-P170) (Accession)

Molecular Weight

25-32 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Transgelin-3 (TAGLN3) (1-199, His-tag) Human Protein
AR50059PU-S 100 µg

Transgelin-3 (TAGLN3) (1-199, His-tag) Human Protein

Ask
View Details
ZYX (zyxin, ESP-2, HED-2) (HRP)
253918-HRP 100 µL

ZYX (zyxin, ESP-2, HED-2) (HRP)

Ask
View Details
Rabbit Polyclonal SGSM1 Antibody [Alexa Fluor 350]
NBP2-81792AF350 0.1 mL

Rabbit Polyclonal SGSM1 Antibody [Alexa Fluor 350]

Ask
View Details
HIF1A (HyP564) (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (Biotin)
MBS6306452-01 0.2 mL

HIF1A (HyP564) (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (Biotin)

Ask
View Details
HIF1A (HyP564) (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (Biotin)
MBS6306452-02 5x 0.2 mL

HIF1A (HyP564) (HIF1A, BHLHE78, MOP1, PASD8, Hypoxia-inducible factor 1-alpha, ARNT-interacting protein, Basic-helix-loop-helix-PAS protein MOP1, Class E basic helix-loop-helix protein 78, Member of PAS protein 1, PAS domain-containing protein 8) (Biotin)

Ask
View Details