Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris)

Hydrophobin-2/HFB2 protein critically imparts spores with hydrophobicity, enhancing their resilience and protective functions. This hydrophobic character, crucial for spore survival, improves resistance to moisture and shields against environmental threats. The significance of Hydrophobin-2/HFB2 in biological strategies is underscored by its role in ensuring the durability and viability of spores in various ecological conditions. Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris) is the recombinant Hydrophobin-2/HFB2 protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris), Others, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hydrophobin-2-protein-trichoderma-reesei-p-pastoris.html

Smiles

AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF

Molecular Formula

18482765 (Gene_ID) P79073 (A16-F86) (Accession)

Molecular Weight

Approximately 23.2 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Buccutite™ Rapid PE-Texas Red Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*
5412-AAT 2 Labelings

Buccutite™ Rapid PE-Texas Red Tandem Antibody Labeling Kit *Production Scale Optimized for Labeling 1 mg Antibody Per Reaction*

Sign In for Pricing
View Details
Tnfaip8l1 (NM_025566) Mouse Tagged ORF Clone
MG201731 10 µg

Tnfaip8l1 (NM_025566) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rbm15 Mouse Gene Knockout Kit (CRISPR)
KN514551 1 Kit

Rbm15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1-(2-Amino-5-hydroxyphenyl)propan-1-one
TRC-A611480-250MG 250 mg

1-(2-Amino-5-hydroxyphenyl)propan-1-one

Sign In for Pricing
View Details
CD9 Mouse Monoclonal Antibody [Clone ID: OTI3D5]
CF813476 100 µg

CD9 Mouse Monoclonal Antibody [Clone ID: OTI3D5]

Sign In for Pricing
View Details
Isonicotinic Acid
TRC-I821760-5G 5 g

Isonicotinic Acid

Sign In for Pricing
View Details