Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris)
Hydrophobin-2/HFB2 protein critically imparts spores with hydrophobicity, enhancing their resilience and protective functions. This hydrophobic character, crucial for spore survival, improves resistance to moisture and shields against environmental threats. The significance of Hydrophobin-2/HFB2 in biological strategies is underscored by its role in ensuring the durability and viability of spores in various ecological conditions. Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris) is the recombinant Hydrophobin-2/HFB2 protein, expressed by P. pastoris , with tag free.
Product Specifications
Product Name Alternative
Hydrophobin-2/HFB2 Protein, Trichoderma reesei (P.pastoris), Others, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hydrophobin-2-protein-trichoderma-reesei-p-pastoris.html
Smiles
AVCPTGLFSNPLCCATNVLDLIGVDCKTPTIAVDTGAIFQAHCASKGSKPLCCVAPVADQALLCQKAIGTF
Molecular Formula
18482765 (Gene_ID) P79073 (A16-F86) (Accession)
Molecular Weight
Approximately 23.2 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF594 conjugate, 0.1mg/mL
