Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICAM-1/CD54, Human (HEK293, His)

The ICAM-1/CD54 protein plays a crucial role in cell interactions, acting as a ligand for the leukocyte adhesion protein LFA-1. It promotes leukocyte transendothelial migration by promoting the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. ICAM-1/CD54 Protein, Human (HEK293, His) is the recombinant human-derived ICAM-1/CD54 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

ICAM-1/CD54 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/icam-1-cd54-protein-human-hek-293-his.html

Purity

98.0

Smiles

QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE

Molecular Formula

3383 (Gene_ID) P05362 (Q28-E480) (Accession)

Molecular Weight

Approximately 81-88 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1238 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K7381105 3x 1.0 µg

Olr1238 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
P53 peptide
orb382232-01 1 mg

P53 peptide

Sign In for Pricing
View Details
P53 peptide
orb382232-02 5 mg

P53 peptide

Sign In for Pricing
View Details
Rabbit Polyclonal HLA A2 Antibody
NBP2-84067-0.1mL 0.1 mL

Rabbit Polyclonal HLA A2 Antibody

Sign In for Pricing
View Details
CTSC Antibody
A18491-50UG 50 µg

CTSC Antibody

Sign In for Pricing
View Details
Mouse Serine/threonine-protein kinase PAK 1, Pak1 ELISA KIT
ELI-14522m 96 Tests

Mouse Serine/threonine-protein kinase PAK 1, Pak1 ELISA KIT

Sign In for Pricing
View Details