Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolactin, Sheep (HEK293, His)

Prolactin Protein, Sheep, (HEK293, His) is a recombinant protein produced by HEK293 cells. Prolactin (PRL) is a 199-amino acid polypeptide hormone mainly synthesized by lactotrope cells in the anterior pituitary. In rodents, PRL has been detected in the preoptic area, hypothalamus, amygdala, and brainstem[1].

Product Specifications

Product Name Alternative

Prolactin Protein, Sheep (HEK293, His), Sheep, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/prolactin-protein-sheep-hek293-his.html

Purity

98.0

Smiles

TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHNLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGVPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARHSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC

Molecular Formula

443317 (Gene_ID) P01240 (T31-C229) (Accession)

Molecular Weight

Approximately 25-30 kDa due to the glycosylation.

References & Citations

[1]Roselli CE, et al. Prolactin expression in the sheep brain. Neuroendocrinology. 2008;87 (4) :206-215.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSTA3 3'UTR GFP Stable Cell Line
TU059380 1.0 mL

GSTA3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tricyclo[6.4.0.0 (2,7) ]dodecane-1,8:2,7-tetracarboxylic Dianhydride
sc-477014 5 g

Tricyclo[6.4.0.0 (2,7) ]dodecane-1,8:2,7-tetracarboxylic Dianhydride

Sign In for Pricing
View Details
TSPAN3 (NM_005724) Human Tagged ORF Clone Lentiviral Particle
RC203876L1V 200 µL

TSPAN3 (NM_005724) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
POFUT2 antibody
70R-5486 50 ug

POFUT2 antibody

Sign In for Pricing
View Details
Trimetrexate
HY-10373-01 5 mg

Trimetrexate

Sign In for Pricing
View Details
Trimetrexate
HY-10373-02 10 mM - 1 mL

Trimetrexate

Sign In for Pricing
View Details