Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Stathmin, Human (C-His)

Stathmin proteins critically regulate the microtubule filament system by actively destabilizing microtubules, inhibiting assembly, and promoting disassembly. Phosphorylation of Ser-16 is critical for axon formation during neurogenesis, highlighting its importance in neuronal development. Stathmin Protein, Human (C-His) is the recombinant human-derived Stathmin protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Stathmin Protein, Human (C-His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/stathmin-protein-human-his.html

Purity

95.0

Smiles

ASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKDKHIEEVRKNKESKDPADETEAD

Molecular Formula

3925 (Gene_ID) P16949-1 (A2-D149) (Accession)

Molecular Weight

Approximately 20.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL
BNC680096-100 1x 100 µL

Histone H1 (AE-4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF488A conjugate, 0.1mg/mL
BNC882250-100 1x 100 µL

Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/468 + C8/144B), CF488A conjugate, 0.1mg/mL
BNC880750-100 1x 100 µL

CD8 (C8/468 + C8/144B), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL
BNC470264-100 1x 100 µL

Human Kappa Light Chain (KLC264), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details