Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Tissue factor (F3), partial (Active)

Product Specifications

Abbreviation

Recombinant Human F3 protein, partial (Active)

Gene Name

F3

UniProt

P13726

Expression Region

33-251aa

Organism

Homo sapiens (Human)

Target Sequence

SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECMGQEKGEFRE

Tag

C-terminal 10xHis-tagged

Type

Active Protein & In Stock Protein

Source

Mammalian cell

Field of Research

Others

Relevance

Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human TF at 2 μg/mL can bind Anti-TF recombinant antibody (CSB-RA007928MA2HU) . The EC50 is 1.434-1.635 ng/mL.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

26.2 kDa

References & Citations

Human tissue factor: cDNA sequence and chromosome localization of the gene. Scarpati E.M., Wen D., Broze G.J. Jr., Miletich J.P., Flandermeyer R.R., Siegel N.R., Sadler J.E. Biochemistry 26:5234-5238 (1987)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CD23 Protein (Fc Tag)
MBS2581079-01 0.02 mg

Recombinant Human CD23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD23 Protein (Fc Tag)
MBS2581079-02 0.1 mg

Recombinant Human CD23 Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Human CD23 Protein (Fc Tag)
MBS2581079-03 5x 0.1 mg

Recombinant Human CD23 Protein (Fc Tag)

Sign In for Pricing
View Details
Map3k4 sgRNA CRISPR Lentivector set (Rat)
K6737401 3x 1.0 µg

Map3k4 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Abhd14a Rat shRNA Lentiviral Particle (Locus ID 300982)
TL701321V 500 µL Each

Abhd14a Rat shRNA Lentiviral Particle (Locus ID 300982)

Sign In for Pricing
View Details
Fentin hydroxide
sc-239993 250 mg

Fentin hydroxide

Sign In for Pricing
View Details