Complement C5a anaphylatoxin, Pig (P.pastoris, His)
Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.
Product Specifications
Product Name Alternative
Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His), Pig, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-pig-p-pastoris-his.html
Smiles
MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR
Molecular Formula
414437 (Gene_ID) P01032 (M1-R74) (Accession)
Molecular Weight
Approximately 10.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items