Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement C5a anaphylatoxin, Pig (P.pastoris, His)

Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-pig-p-pastoris-his.html

Smiles

MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR

Molecular Formula

414437 (Gene_ID) P01032 (M1-R74) (Accession)

Molecular Weight

Approximately 10.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Magic™ Membrane Protein Human CSF1 (Colony stimulating factor 1, transcript variant 2) for Antibody Discovery
MP1255J Each

Magic™ Membrane Protein Human CSF1 (Colony stimulating factor 1, transcript variant 2) for Antibody Discovery

Ask
View Details
Lman2 (NM_001115024) Rat Tagged Lenti ORF Clone
RR214400L3 10 µg

Lman2 (NM_001115024) Rat Tagged Lenti ORF Clone

Ask
View Details
Lentiviral mouse Cdhr1 shRNA (UAS) - Lentiviral mouseCdhr1 shRNA (UAS, GFP) (25)
GTR15220700 1 Vial

Lentiviral mouse Cdhr1 shRNA (UAS) - Lentiviral mouseCdhr1 shRNA (UAS, GFP) (25)

Ask
View Details
CD200 Protein (C-His-AVI, Human)
P522749 100 µg

CD200 Protein (C-His-AVI, Human)

Ask
View Details
Ltb4r1 (NM_008519) Mouse Tagged ORF Clone Lentiviral Particle
MR205333L3V 200 µL

Ltb4r1 (NM_008519) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details