Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Complement C5a anaphylatoxin, Pig (P.pastoris, His)

Complement C5/C5a Protein, a component of the complement system, is involved in the immune response and inflammation. It is cleaved to generate C5a, a potent pro-inflammatory mediator. Complement C5/C5a Protein's role in immune regulation and its potential as a therapeutic target make it a promising candidate for the treatment of inflammatory disorders and autoimmune diseases. Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His) is the recombinant pig-derived Complement C5a anaphylatoxin protein, expressed by P. pastoris , with N-His labeled tag.

Product Specifications

Product Name Alternative

Complement C5a anaphylatoxin Protein, Pig (P.pastoris, His), Pig, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/complement-c5-c5a-protein-pig-p-pastoris-his.html

Smiles

MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR

Molecular Formula

414437 (Gene_ID) P01032 (M1-R74) (Accession)

Molecular Weight

Approximately 10.6 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Cimetidine Amide Dihydrochloride
TRC-C441660-25MG 25 mg

Cimetidine Amide Dihydrochloride

Ask
View Details
Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)
MBS2101346-01 5x 96 Tests

Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)

Ask
View Details
Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)
MBS2101346-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)

Ask
View Details
Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)
MBS2101346-03 10x 96 Tests

Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)

Ask
View Details
Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)
MBS2101346-04 10x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1, 10x 96 Tests)

Mouse Gremlin 1 (GREM1) Antibody Pair Kit (with Standard)

Ask
View Details
Serum Paraoxonase/arylesterase 2 (PON2) Antibody
abx036896-01 100 µg

Serum Paraoxonase/arylesterase 2 (PON2) Antibody

Ask
View Details