Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Double-stranded RNA-specific adenosine deaminase (ADAR), partial

Product Specifications

Product Name Alternative

136 kDa double-stranded RNA-binding protein (p136) (Interferon-inducible protein 4) (IFI-4) (K88DSRBP) (ADAR1) (DSRAD) (G1P1) (IFI4) (DRADA)

Abbreviation

Recombinant Human ADAR protein, partial

Gene Name

ADAR

UniProt

P55265

Expression Region

1-176aa

Organism

Homo sapiens (Human)

Target Sequence

MNPRQGYSLSGYYTHPFQGYEHRQLRYQQPGPGSSPSSFLLKQIEFLKGQLPEAPVIGKQTPSLPPSLPGLRPRFPVLLASSTRGRQVDIRGVPRGVHLRSQGLQRGFQHPSPRGRSLPQRGVDCLSSHFQELSIYQDQEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVL

Tag

C-terminal hFc1-tagged

Type

Developed Protein

Source

Mammalian cell

Field of Research

Epigenetics and Nuclear Signaling

Relevance

Catalyzes the hydrolytic deamination of adenosine to inosine in double-stranded RNA referred to as A-to-I RNA editing. This may affect gene expression and function in a number of ways that include mRNA translation by changing codons and hence the amino acid sequence of proteins; pre-mRNA splicing by altering splice site recognition sequences; RNA stability by changing sequences involved in nuclease recognition; genetic stability in the case of RNA virus genomes by changing sequences during viral RNA replication; and RNA structure-dependent activities such as microRNA production or targeting or protein-RNA interactions. Can edit both viral and cellular RNAs and can edit RNAs at multiple sites or at specific sites. Its cellular RNA substrates include: bladder cancer-associated protein, neurotransmitter receptors for glutamate and serotonin and GABA receptor. Site-specific RNA editing of transcripts encoding these proteins results in amino acid substitutions which consequently alters their functional activities. Exhibits low-level editing at the GRIA2 Q/R site, but edits efficiently at the R/G site and HOTSPOT1. Its viral RNA substrates include: hepatitis C virus, vesicular stomatitis virus, measles virus, hepatitis delta virus, and human immunodeficiency virus type 1. Exhibits either a proviral or an antiviral effect and this can be editing-dependent, editing-independent or both. Impairs HCV replication via RNA editing at multiple sites. Enhances the replication of MV, VSV and HIV-1 through an editing-independent mechanism via suppression of EIF2AK2/PKR activation and function. Stimulates both the release and infectivity of HIV-1 viral particles by an editing-dependent mechanism where it associates with viral RNAs and edits adenosines in the 5'UTR and the Rev and Tat coding sequence. Can enhance viral replication of HDV via A-to-I editing at a site designated as amber/W, thereby changing an UAG amber stop codon to an UIG tryptophan codon that permits synthesis of the large delta antigen which has a key role in the assembly of viral particles. However, high levels of ADAR1 inhibit HDV replication.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

48.6 kDa

References & Citations

"Human RNA-specific adenosine deaminase ADAR1 transcripts possess alternative exon 1 structures that initiate from different promoters, one constitutively active and the other interferon inducible." George C.X., Samuel C.E. Proc. Natl. Acad. Sci. U.S.A. 96:4621-4626 (1999)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAGE1 Human Gene Knockout Kit (CRISPR)
KN402446 1 Kit

PAGE1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IL-4 / Interleukin 4 (IL4/1597), CF640R conjugate, 0.1mg/mL
BNC401597-500 1x 500 µL

IL-4 / Interleukin 4 (IL4/1597), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-II-,  10nm
GP-2402-10 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-II-, 10nm

Sign In for Pricing
View Details
Bovine Amphiregulin (AREG) ELISA Kit
RDR-AREG-b-01 96 Tests

Bovine Amphiregulin (AREG) ELISA Kit

Sign In for Pricing
View Details
Bovine Amphiregulin (AREG) ELISA Kit
RDR-AREG-b-02 48 Tests

Bovine Amphiregulin (AREG) ELISA Kit

Sign In for Pricing
View Details
Polystyrene A Br
HA40045001.5G 5 g

Polystyrene A Br

Sign In for Pricing
View Details