Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Haptoglobin (HP), partial

Product Specifications

Product Name Alternative

Zonulin

Abbreviation

Recombinant Human HP protein, partial

Gene Name

HP

UniProt

P00738

Expression Region

1-134aa

Organism

Homo sapiens (Human)

Target Sequence

MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWI

Tag

N-terminal 6xHis-KSI-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity, and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidly cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway. ; The uncleaved form of allele alpha-2 (2-2), known as zonulin, plays a role in intestinal permeability, allowing intercellular tight junction disassembly, and controlling the equilibrium between tolerance and immunity to non-self antigens.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

30.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
24314064 1.0 µg DNA

IGF2 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
ACTB Antibody
A30273-50UG 50 µg

ACTB Antibody

Sign In for Pricing
View Details
NAGLU, Recombinant, Human (NAG, UFHSD1, Alpha-N-acetylglucosaminidase, N-acetyl-alpha-glucosaminidase)
N0017-06 20 µg

NAGLU, Recombinant, Human (NAG, UFHSD1, Alpha-N-acetylglucosaminidase, N-acetyl-alpha-glucosaminidase)

Sign In for Pricing
View Details
Recombinant Shigella Flexneri fliQ Protein (aa 1-89)
VAng-Lsx07752-inquire Inquire

Recombinant Shigella Flexneri fliQ Protein (aa 1-89)

Sign In for Pricing
View Details
CLIC2 Rabbit Polyclonal Antibody
orb575359 100 µL

CLIC2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Biotinylated Human HLA-A*02:01&B2M&PRAME (ALYVDSLFFL) Complex Protein (Monomer, MALS verified)
HLE-H82E6-200ug 200 µg

Biotinylated Human HLA-A*02:01&B2M&PRAME (ALYVDSLFFL) Complex Protein (Monomer, MALS verified)

Sign In for Pricing
View Details