FGF-5, Human (GST)
The FGF-5 protein critically regulates cell proliferation and differentiation, particularly during the hair growth cycle. It plays a key role in normal hair follicle progression, inhibiting hair elongation by promoting the anagen to catagen transition. FGF-5 Protein, Human (GST) is the recombinant human-derived FGF-5 protein, expressed by E. coli , with N-GST labeled tag.
Product Specifications
Product Name Alternative
FGF-5 Protein, Human (GST), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/fgf-5-protein-human-gst.html
Smiles
AWAHGEKRLAPKGQPGPAATDRNPRGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPSPIKPKIPLSAPRKNTNSVKYRLKFRFG
Molecular Formula
2250 (Gene_ID) P12034-1 (A18-G268) (Accession)
Molecular Weight
54.6 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Scientific Category
Recombinant Proteins
Available Sizes
Curated Selection
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
583747-01 20 µg
B-lymphocyte Antigen CD19, Recombinant, Human, aa20-291, His-Tag, Myc-Tag
Ask
View Details 583747-02 100 µg
B-lymphocyte Antigen CD19, Recombinant, Human, aa20-291, His-Tag, Myc-Tag
Ask
View Details 
131602 100 µg
POLR3K (DNA-directed RNA Polymerase III Subunit RPC10, RNA Polymerase III Subunit C10, DNA-directed RNA Polymerase III Subunit K, RNA Polymerase III 12.5kD Subunit, RPC12.5, RNA Polymerase III Subunit C11, HsC11p, RPC11, hRPC11, My010, C11-RNP3, RPC12.5)
Ask
View Details