Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JAM-C/CD323, Mouse (HEK293, His)

JAM-C/CD323 protein and JAM2 participate in a variety of cell-cell interactions and regulate cellular processes. It plays a key role in the homing and retention of hematopoietic cells in the bone marrow. JAM-C/CD323 Protein, Mouse (HEK293, His) is the recombinant mouse-derived JAM-C/CD323 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

JAM-C/CD323 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/jam-c-cd323-protein-mouse-hek293-his.html

Purity

97.00

Smiles

EAVNLKSSNRNPVVHEFESVELSCIITDSQTSDPRIEWKKIQDGQTTYVYFDNKIQGDLAGRTDVFGKTSLRIWNVTRSDSAIYRCEVVALNDRKEVDEITIELIVQVKPVTPVCRIPAAVPVGKTATLQCQESEGYPRPHYSWYRNDVPLPTDSRANPRFQNSSFHVNSETGTLVFNAVHKDDSGQYYCIASNDAGAARCEGQDMEVYDLN

Molecular Formula

83964 (Gene_ID) Q9D8B7/NP_075766.1 (E30-N241) (Accession)

Molecular Weight

Approximately 27-34 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX19B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV638781 1.0 µg DNA

DDX19B Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral mouse Pigw shRNA (UAS) - Lentiviral mouse Pigw shRNA (UAS, GFP) plasmid
GTR15172906 1 Vial

Lentiviral mouse Pigw shRNA (UAS) - Lentiviral mouse Pigw shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
BDE 132 10ug/ml in Iso-octane
BDE13201ZT10 10 mL

BDE 132 10ug/ml in Iso-octane

Sign In for Pricing
View Details
Anti-ATG7/Apg7 Rabbit Monoclonal Antibody
MBS179280-01 0.03 mL

Anti-ATG7/Apg7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-ATG7/Apg7 Rabbit Monoclonal Antibody
MBS179280-02 0.1 mL

Anti-ATG7/Apg7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-ATG7/Apg7 Rabbit Monoclonal Antibody
MBS179280-03 5x 0.1 mL

Anti-ATG7/Apg7 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details