Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

USP14, Human (399a.a, His)

Product Specifications

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/usp14-protein-human-399a-a-his.html

Purity

94.00

Smiles

LASAMELPCGLTNLGNTCYMNATVQCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLHMAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSVKETDSSSASAATPSKKKSLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITKQSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDMYELCTPELQEKMVSFRSKFKDLEDKKVNQQPNTSDKKSSPQKEVKYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ

Molecular Weight

Approximately 47.6 kDa

Shipping Conditions

Dry Ice

Storage Conditions

Stored at -80°C for 1 year

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF647 conjugate, 0.1mg/mL
BNC470175-100 1x 100 µL

CD46 (122.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL
BNC470437-500 1x 500 µL

CD47 (B6H12.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF568 conjugate, 0.1mg/mL
BNC682810-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2810R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF568 conjugate, 0.1mg/mL
BNC681101-500 1x 500 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL
BNC881868-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (rGYPA/280), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details