Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L2, Rat (HEK293, His)

Programmed cell death 1 ligand 2 (Pdcd1lg2, Pd-l2, B7-DC) is a member of B7 family and a ligand of programmed cell death 1. Pdcd1lg2 negatively regulates activated T cell proliferation, interferon-gamma production and interleukin-10 production in a PDCD1-independent manner, or inhibits T-cell proliferation by blocking cell cycle progression and cytokine production by interacts with PDCD1, and consequently causes cancer growth and suppresses the immune system. PD-L2 Protein, Rat (HEK293, His) is the recombinant rat-derived PD-L2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

PD-L2 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l2-protein-rat-hek293-his.html

Purity

98.0

Smiles

LFTVTAPKEVYTVDFGSSVSLECDFDRRECTELEGIRASLQKVENDTSSQSQRATLLEELLPLGKASFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYVRIDTGILEVPGTGEVQLICQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPLSWMEPKVPR

Molecular Formula

309304 (Gene_ID) D4AAV6 (L20-R219) (Accession)

Molecular Weight

Approximately 35.7 kDa

References & Citations

[1]Bolandi N, et al. The Positive and Negative Immunoregulatory Role of B7 Family: Promising Novel Targets in Gastric Cancer Treatment. Int J Mol Sci. 2021 Oct 3;22 (19) :10719.|[2]Latchman Y, et al. PD-L2 is a second ligand for PD-1 and inhibits T cell activation. Nat Immunol. 2001 Mar;2 (3) :261-8.|[3]Tseng SY, et al. B7-DC, a new dendritic cell molecule with potent costimulatory properties for T cells. J Exp Med. 2001 Apr 2;193 (7) :839-46.|[4]Wang S, et al. Molecular modeling and functional mapping of B7-H1 and B7-DC uncouple costimulatory function from PD-1 interaction. J Exp Med. 2003 May 5;197 (9) :1083-91.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Calsequestrin, Antibody
GWB-65354B 0.1 mL

Calsequestrin, Antibody

Ask
View Details
RHBDL1 (NM_003961) Human Over-expression Lysate
LC418311 20 µg

RHBDL1 (NM_003961) Human Over-expression Lysate

Ask
View Details
Human MYOZ1 Pre-designed siRNA Set A
SI010174A 1 Each

Human MYOZ1 Pre-designed siRNA Set A

Ask
View Details
Ducted PP Fume Hood
LX21DFH 1 Unit

Ducted PP Fume Hood

Ask
View Details