Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human UBA-like domain-containing protein 2 (UBALD2)

Product Specifications

Abbreviation

Recombinant Human UBALD2 protein

Gene Name

UBALD2

UniProt

Q8IYN6

Expression Region

2-164aa

Organism

Homo sapiens (Human)

Target Sequence

SVNMDELRHQVMINQFVLAAGCAADQAKQLLQAAHWQFETALSTFFQETNIPNSHHHHQMMCTPSNTPATPPNFPDALAMFSKLRASEGLQSSNSPMTAAACSPPANFSPFWASSPPSHQAPWIPPSSPTTFHHLHRPQPTWPPGAQQGGAQQKAMAAMDGQR

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

25.2 kDa

References & Citations

"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB." Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R. Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454 (2012)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
BNC880149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (NX2.1/690), CF405S conjugate, 0.1mg/mL
BNC040690-500 1x 500 µL

TTF-1 / NKX2.1 (NX2.1/690), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL
BNC400177-500 1x 500 µL

CD50 (ICAM-3) (101-1D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, multi (C11), CF568 conjugate, 0.1mg/mL
BNC680393-100 1x 100 µL

Cytokeratin, multi (C11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF640R conjugate, 0.1mg/mL
BNC401125-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1125), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details