ARF1, Human (His-GST, Myc)
ARF1 is a small GTPase responsible for coordinating protein transport within the Golgi complex. In its GTP-bound state, ARF1 critically regulates Golgi vesicle budding and uncoating by recruiting coat proteins. ARF1 Protein, Human (His-GST, Myc) is the recombinant human-derived ARF1 protein, expressed by E. coli , with N-10*His, C-Myc, GST labeled tag.
Product Specifications
Product Name Alternative
ARF1 Protein, Human (His-GST, Myc), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/arf1-protein-human-his-gst-myc.html
Purity
90.0
Smiles
GNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQK
Molecular Formula
375 (Gene_ID) P84077 (G2-K181) (Accession)
Molecular Weight
Approximately 55 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
S1040-06F-ML550 100 µL
SOCS6 (Suppressor of Cytokine Signaling 6, SOCS-6, Cytokine-inducible SH2 Protein 4, CIS-4, Suppressor of Cytokine Signaling 4, SOCS-4, CIS4, SOCS4) (MaxLight 550)
Sign In for Pricing
View Details NBP2-98912AF700 0.1 mL
Rabbit Polyclonal JAM-4/IGSF5 Antibody [Alexa Fluor 700]
Sign In for Pricing
View Details K2705506 1.0 µg DNA
ZNF428 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
Sign In for Pricing
View Details 
11852126 3x 1.0µg DNA
AMPD3 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details