Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Serpin A3N, Mouse (HEK293, His)

The serpin A3N protein is ubiquitously found in a variety of tissues, showing elevated expression in the brain, heart, liver, lung, spleen, testis, and thymus, implying a variety of physiological functions.In contrast, it shows lower expression in bone marrow, kidney, and skeletal muscle, suggesting a tissue-specific pattern of regulation.Serpin A3N Protein, Mouse (HEK293, His) is the recombinant mouse-derived Serpin A3N protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Serpin A3N Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/serpin-a3n-protein-mouse-hek-293-his.html

Purity

97

Smiles

FPDGTLGMDAAVQEDHDNGTQLDSLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTETSEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKAKTLYQAEAFTADFQQPRQAKKLINDYVRKQTQGMIKELVSDLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRPVIVPMMSMEDLTTPYFRDEELSCTVVELKYTGNASALFILPDQGRMQQVEASLQPETLRKWKNSLKPRMIDELHLPKFSISTDYSLEDVLSKLGIREVFSTQADLSAITGTKDLRVSQVVHKAVLDVAETGTEAAAATGVKFVPMSAKLYPLTVYFNRPFLIMIFDTETEIAPFIAKIANPK

Molecular Formula

20716 (Gene_ID) Q91WP6 (F21-K418) (Accession)

Molecular Weight

57-61 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

KRTAP7-1 (NM_181606) Human Over-expression Lysate
LS337878-100ug 100 µg

KRTAP7-1 (NM_181606) Human Over-expression Lysate

Ask
View Details
JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine
MBS644256-01 0.1 mL

JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine

Ask
View Details
JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine
MBS644256-02 5x 0.1 mL

JIK (JNK/SAPK-inhibitory Kinase, Jun Kinase Inhibitory Kinase, Cutaneous T-cell Lymphoma-associated Antigen HD-CL-09, CTCL-associated Antigen HD-CL-09, Dendritic Cell-derived Protein Kinase, DPK, KDS, Kinase from Chicken Homolog A, hKFC-A, MAP3K18, Serine

Ask
View Details
Human Collagen alpha-4(IV) chain, COL4A4 ELISA KIT
ELI-32364h 96 Tests

Human Collagen alpha-4(IV) chain, COL4A4 ELISA KIT

Ask
View Details
HDAC1 Polyclonal Antibody
UB-GEN-1719 100 µL

HDAC1 Polyclonal Antibody

Ask
View Details
Myristoylated ARF6 (2-13), scrambled
HY-P10186 1 Each

Myristoylated ARF6 (2-13), scrambled

Ask
View Details