Carbonic Anhydrase 14, Human (His)
Product Specifications
UNSPSC Description
Carbonic Anhydrase 14 Protein, Human (His) is an approximately 40.0 kDa human carbonic anhydrase 14 protein with a His-flag. Carbonic Anhydrase 14 is a type I membrane enzyme highly expressed in all parts of the central nervous system[1].
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/carbonic-anhydrase-14-protein-human-his.html
Purity
85.00
Smiles
HHHHHHGQHWTYEGPHGQDHWPASYPECGNNAQSPIDIQTDSVTFDPDLPALQPHGYDQPGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATFAELHIVHYDSDSYDSLSEAAERPQGLAVLGILIEVGETKNIAYEHILSHLHEVRHKDQKTSVPPFNLRELLPKQLGQYFRYNGSLTTPPCYQSVLWTVFYRRSQISMEQLEKLQGTLFSTEEEPSKLLVQNYRALQPLNQRMVFASFIQAGSSYTTGEM
Molecular Weight
Approximately 40.0 kDa
References & Citations
[1]D Hewett-Emmett, et al. Functional diversity, conservation, and convergence in the evolution of the alpha-, beta-, and gamma-carbonic anhydrase gene families. Mol Phylogenet Evol|[2]K Fujikawa-Adachi, et al. Human carbonic anhydrase XIV (CA14): cDNA cloning, mRNA expression, and mapping to chromosome 1. Genomics. 1999 Oct 1;61(1):74-81.
Shipping Conditions
Dry Ice
Storage Conditions
Stored at -80°C for 1 year
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2311-100 1x 100 µL
SOX10 (Melanoma Marker) (SOX10/2311R), 0.2mg/mL
Sign In for Pricing
View Details 
