Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD2, Canine (HEK293, His)

CD2 Protein is a cell surface glycoprotein that is expressed on the surface of T cells, NK cells, thymus cells and dendritic cells. The CD2 Protein mediates the adhesion of T cells to various cell types and triggers T cell responses through interactions with lymphocyte function-related antigens CD58 (LFA-3) and CD48/BCM1. CD2 Protein, Canine (HEK293, His) is the recombinant canine-derived CD2 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

CD2 Protein, Canine (HEK293, His), Canine, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd2-protein-canine-hek293-his.html

Purity

98.0

Smiles

EVLETKLVWGALGHDFDLDSAGFQMNAKIDHIRWEKGKTKVAELKTGILKDTHGKYNISTNGFLKIKHLMMNDSDIYKVAIYDKDGKSVLRRNYQLKIQEKVSTPKILWSCGNQSLTCEITSGTDPTLMLYVNQTMIKNLLNMTIVQWNWTSQQEMTVSCTAKNEVSQKREEKIINCSEKGLD

Molecular Formula

607448 (Gene_ID) XP_849219.1 (E22-D204) (Accession)

Molecular Weight

Approximately 35-45 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Fetuin A/AHSG Antibody Picoband® (Biotine Conjugate)
PB9242-Biotin 100 µg/Vial

Anti-Fetuin A/AHSG Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
2- (2- (2,3,6-Triazino[5,4-β]indol-3-ylthio) acetylhydrazide
FT169587 5000 mg

2- (2- (2,3,6-Triazino[5,4-β]indol-3-ylthio) acetylhydrazide

Sign In for Pricing
View Details
WDR19 Antibody (HRP)
orb51879-01 50 µg

WDR19 Antibody (HRP)

Sign In for Pricing
View Details
WDR19 Antibody (HRP)
orb51879-02 100 µg

WDR19 Antibody (HRP)

Sign In for Pricing
View Details
PSMD14 3'UTR Luciferase Stable Cell Line
TU019082 1.0 mL

PSMD14 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
8-Formylophiopogonone B
HY-N13108 1 Each

8-Formylophiopogonone B

Sign In for Pricing
View Details