Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAS-6 Centriolar Assembly Protein (SASS6) Antibody
abx237613 100 µg

SAS-6 Centriolar Assembly Protein (SASS6) Antibody

Sign In for Pricing
View Details
INSC Polyclonal Antibody, AbBy Fluor™ 405 Conjugated
bs-7838R-BF405 100 µL

INSC Polyclonal Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Mouse Probable crossover junction endonuclease EME2 (EME2) ELISA Kit
abx521982 96 Tests

Mouse Probable crossover junction endonuclease EME2 (EME2) ELISA Kit

Sign In for Pricing
View Details
Nectin-4 Protein, Mouse, Recombinant (hFc)
MF-0108150-01 5 µg

Nectin-4 Protein, Mouse, Recombinant (hFc)

Sign In for Pricing
View Details
Nectin-4 Protein, Mouse, Recombinant (hFc)
MF-0108150-02 10 µg

Nectin-4 Protein, Mouse, Recombinant (hFc)

Sign In for Pricing
View Details
Nectin-4 Protein, Mouse, Recombinant (hFc)
MF-0108150-03 20 µg

Nectin-4 Protein, Mouse, Recombinant (hFc)

Sign In for Pricing
View Details