Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)
MBS1327115-01 0.05 mg (E-Coli)

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)
MBS1327115-02 0.05 mg (Yeast)

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)
MBS1327115-03 0.2 mg (E-Coli)

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)
MBS1327115-04 0.5 mg (E-Coli)

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)
MBS1327115-05 0.05 mg (Baculovirus)

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)

Sign In for Pricing
View Details
Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)
MBS1327115-06 0.2 mg (Yeast)

Recombinant Kluyveromyces lactis Cap-associated protein CAF20 (CAF20)

Sign In for Pricing
View Details