Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Aldehydo-isoophiopogonone A
MBS5787586 Inquire

6-Aldehydo-isoophiopogonone A

Sign In for Pricing
View Details
Mouse Monoclonal Complement Component C5aR1 Antibody (32-G1) [FITC]
NBP3-12084F 0.1 mL

Mouse Monoclonal Complement Component C5aR1 Antibody (32-G1) [FITC]

Sign In for Pricing
View Details
Human hsa-miR-6728-3p miRNA Antagomir
abx887368-01 10 nmol

Human hsa-miR-6728-3p miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-6728-3p miRNA Antagomir
abx887368-02 20 nmol

Human hsa-miR-6728-3p miRNA Antagomir

Sign In for Pricing
View Details
RBM14 (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (FITC)
MBS6149260-01 0.1 mL

RBM14 (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (FITC)

Sign In for Pricing
View Details
RBM14 (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (FITC)
MBS6149260-02 5x 0.1 mL

RBM14 (RNA-binding Protein 14, RNA-binding Motif Protein 14, RRM-containing Coactivator Activator/Modulator, Synaptotagmin-interacting Protein, SYT-interacting Protein, Paraspeckle Protein 2, PSP2, SIP) (FITC)

Sign In for Pricing
View Details