Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sjogren Syndrome Nuclear Autoantigen 1 (SSNA1) Antibody
abx007183-01 20 µL

Sjogren Syndrome Nuclear Autoantigen 1 (SSNA1) Antibody

Sign In for Pricing
View Details
Sjogren Syndrome Nuclear Autoantigen 1 (SSNA1) Antibody
abx007183-02 10 µg

Sjogren Syndrome Nuclear Autoantigen 1 (SSNA1) Antibody

Sign In for Pricing
View Details
Sjogren Syndrome Nuclear Autoantigen 1 (SSNA1) Antibody
abx007183-03 50 µL

Sjogren Syndrome Nuclear Autoantigen 1 (SSNA1) Antibody

Sign In for Pricing
View Details
Sord 3'UTR Luciferase Stable Cell Line
TU220975 1.0 mL

Sord 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Fam71a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6521308 1.0 µg DNA

Fam71a sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
LRP5L CytoSection
TS427910P5 25 Slides

LRP5L CytoSection

Sign In for Pricing
View Details