Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ND6 Antibody
MBS3209862-01 0.1 mL

ND6 Antibody

Sign In for Pricing
View Details
ND6 Antibody
MBS3209862-02 5x 0.1 mL

ND6 Antibody

Sign In for Pricing
View Details
RPS26P21 CRISPRa sgRNA lentivector (set of three targets)(Human)
42307121 3x 1.0µg DNA

RPS26P21 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mouse Monoclonal Ovalbumin Antibody (2C6) [Alexa Fluor 405]
NB100-62809AF405 0.1 mL

Mouse Monoclonal Ovalbumin Antibody (2C6) [Alexa Fluor 405]

Sign In for Pricing
View Details
KRTAP1-3 ORF Vector (Human) (pORF)
ORF022501 1.0 µg DNA

KRTAP1-3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Protein notum homolog (NOTUM) Elisa Kit
EK731362 96 Well

Mouse Protein notum homolog (NOTUM) Elisa Kit

Sign In for Pricing
View Details