Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Neurokinin 1 receptor (NK1R) ELISA Kit
OM626430 96 Tests

Mouse Neurokinin 1 receptor (NK1R) ELISA Kit

Sign In for Pricing
View Details
Mouse RBP4 (Retinol Binding Protein 4, Plasma) CLIA Kit
MBS2532888-01 96 Tests

Mouse RBP4 (Retinol Binding Protein 4, Plasma) CLIA Kit

Sign In for Pricing
View Details
Mouse RBP4 (Retinol Binding Protein 4, Plasma) CLIA Kit
MBS2532888-02 5x 96 Tests

Mouse RBP4 (Retinol Binding Protein 4, Plasma) CLIA Kit

Sign In for Pricing
View Details
Human C1 esterase inhibitor AssayLite™ Antibody (FITC Conjugate)
36819-05141 2x 75 µg

Human C1 esterase inhibitor AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
PLV3-U6-SLC25A1-shRNA1-CopGFP-Puro Plasmid
PVT64823 2 µg

PLV3-U6-SLC25A1-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Anti-XIAP Rabbit pAb
GB111208-50 50 μL

Anti-XIAP Rabbit pAb

Sign In for Pricing
View Details