Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Baiap2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6573202 1.0 µg DNA

Baiap2 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Mouse Monoclonal TMIGD2 Antibody (953743) [Allophycocyanin/Cy7]
FAB83162APCCY7 0.1 mL

Mouse Monoclonal TMIGD2 Antibody (953743) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
TOM1L2, CT (TOM1L2, TOM1-like protein 2, Target of Myb-like protein 2) (Biotin)
MBS6357320-01 0.2 mL

TOM1L2, CT (TOM1L2, TOM1-like protein 2, Target of Myb-like protein 2) (Biotin)

Sign In for Pricing
View Details
TOM1L2, CT (TOM1L2, TOM1-like protein 2, Target of Myb-like protein 2) (Biotin)
MBS6357320-02 5x 0.2 mL

TOM1L2, CT (TOM1L2, TOM1-like protein 2, Target of Myb-like protein 2) (Biotin)

Sign In for Pricing
View Details
PLA2G2A Protein, Mouse, Recombinant (His Tag)
MBS8122611-01 0.05 mg

PLA2G2A Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details
PLA2G2A Protein, Mouse, Recombinant (His Tag)
MBS8122611-02 5x 0.05 mg

PLA2G2A Protein, Mouse, Recombinant (His Tag)

Sign In for Pricing
View Details