Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (MaxLight 490)
MBS6395450-01 0.1 mL

STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (MaxLight 490)

Sign In for Pricing
View Details
STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (MaxLight 490)
MBS6395450-02 5x 0.1 mL

STOM (Erythrocyte Band 7 Integral Membrane Protein, Protein 7.2b, Stomatin, BND7, EPB72) (MaxLight 490)

Sign In for Pricing
View Details
Recombinant Rhesus Macaque SLC25A45 Protein, His (Fc)-Avi-tagged
SLC25A45-4075R 50 µg

Recombinant Rhesus Macaque SLC25A45 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
MYO9A (Unconventional Myosin-IXa, Unconventional Myosin-9a, MYR7, FLJ11061, FLJ13244, MGC71859) (MaxLight 650)
130078-ML650 100 µL

MYO9A (Unconventional Myosin-IXa, Unconventional Myosin-9a, MYR7, FLJ11061, FLJ13244, MGC71859) (MaxLight 650)

Sign In for Pricing
View Details
Ap4dT
HY-168345A 1 Each

Ap4dT

Sign In for Pricing
View Details
Rabbit Polyclonal 14-3-3 eta Antibody [Janelia Fluor 646]
NBP2-99642JF646 0.1 mL

Rabbit Polyclonal 14-3-3 eta Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details