Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rdh10 (NM_181478) Rat Tagged Lenti ORF Clone
RR201146L4 10 µg

Rdh10 (NM_181478) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody
TA335217 100 µL

TFIIE beta (GTF2E2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DPF2 siRNA (Human)
MBS8217122-01 15 nmol

DPF2 siRNA (Human)

Sign In for Pricing
View Details
DPF2 siRNA (Human)
MBS8217122-02 30 nmol

DPF2 siRNA (Human)

Sign In for Pricing
View Details
DPF2 siRNA (Human)
MBS8217122-03 5x 30 nmol

DPF2 siRNA (Human)

Sign In for Pricing
View Details
ADSS1 Antibody
KC-34957-01 50 μL

ADSS1 Antibody

Sign In for Pricing
View Details