Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBFC0996 Plasmid
PVT66332 2 µg

PBFC0996 Plasmid

Sign In for Pricing
View Details
GCLC Rabbit mAb
A4499-01 20 µL

GCLC Rabbit mAb

Sign In for Pricing
View Details
GCLC Rabbit mAb
A4499-02 100 μL

GCLC Rabbit mAb

Sign In for Pricing
View Details
GCLC Rabbit mAb
A4499-03 500 μL

GCLC Rabbit mAb

Sign In for Pricing
View Details
GCLC Rabbit mAb
A4499-04 1000 μL

GCLC Rabbit mAb

Sign In for Pricing
View Details
Biotin-IkB Inhibitor, amide
5-00792 4x 1 mg

Biotin-IkB Inhibitor, amide

Sign In for Pricing
View Details