Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TARM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46130111 3x 1.0 µg

TARM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Prickle-Like Protein 1 (PRICKLE1) Antibody
abx122617-01 100 µg

Prickle-Like Protein 1 (PRICKLE1) Antibody

Sign In for Pricing
View Details
Prickle-Like Protein 1 (PRICKLE1) Antibody
abx122617-02 1 mg

Prickle-Like Protein 1 (PRICKLE1) Antibody

Sign In for Pricing
View Details
Rhag (NM_011269) Mouse Tagged ORF Clone
MR224192 10 µg

Rhag (NM_011269) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PUF60 Antibody
MBS7051376-01 0.05 mg

PUF60 Antibody

Sign In for Pricing
View Details
PUF60 Antibody
MBS7051376-02 0.1 mg

PUF60 Antibody

Sign In for Pricing
View Details