Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal RHD Antibody (LFB Anti-RhD) [DyLight 405]
NBP3-27995V 0.1 mL

Human Monoclonal RHD Antibody (LFB Anti-RhD) [DyLight 405]

Sign In for Pricing
View Details
IL33, ID (Interleukin-33, IL-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor From High Endothelial Venules, NF-HEV, C9orf26, IL1F11, NFHEV)
146182 100 µg

IL33, ID (Interleukin-33, IL-33, Interleukin-1 Family Member 11, IL-1F11, Nuclear Factor From High Endothelial Venules, NF-HEV, C9orf26, IL1F11, NFHEV)

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS805081 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
SYN2 (Synapsin-2, Synapsin II)
493224 100 µL

SYN2 (Synapsin-2, Synapsin II)

Sign In for Pricing
View Details
Mouse Monoclonal Fc gamma RI/CD64 Antibody (22) [Janelia Fluor 646]
FAB12572J 0.1 mL

Mouse Monoclonal Fc gamma RI/CD64 Antibody (22) [Janelia Fluor 646]

Sign In for Pricing
View Details
RN5S465 Protein Vector (Human) (pPB-C-His)
PV117546 500 ng

RN5S465 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details