Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

EMID1 (NM_133455) Human Tagged ORF Clone Lentiviral Particle
RC208157L4V 200 µL

EMID1 (NM_133455) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Kynureninic Acid/Quinolinic Acid ELISA pack
ISE-0102R 296 Well

Kynureninic Acid/Quinolinic Acid ELISA pack

Sign In for Pricing
View Details
8- (4-Chlorophenylthio) -2'-O-methyladenosine 3',5'-cyclic Monophosphate Sodium Salt
439923 1 mg

8- (4-Chlorophenylthio) -2'-O-methyladenosine 3',5'-cyclic Monophosphate Sodium Salt

Sign In for Pricing
View Details
WB 3559 A
HY-113769 1 Each

WB 3559 A

Sign In for Pricing
View Details
Bovine Endothelin Converting Enzyme 1 ELISA Kit
OM621471 96 Strip Well

Bovine Endothelin Converting Enzyme 1 ELISA Kit

Sign In for Pricing
View Details
RFPL3S Human shRNA Lentiviral Particle (Locus ID 10737)
TL318929V 500 µL Each

RFPL3S Human shRNA Lentiviral Particle (Locus ID 10737)

Sign In for Pricing
View Details