Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal PEX3 Antibody [Alexa Fluor 750]
NBP3-06433AF750 0.1 mL

Rabbit Polyclonal PEX3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
Cib3 (NM_001080812) Mouse Tagged ORF Clone Lentiviral Particle
MR212926L4V 200 µL

Cib3 (NM_001080812) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Gucy1b2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3153306 1.0 µg DNA

Gucy1b2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human SYT5 Pre-designed siRNA Set A
SI016150A 1 Each

Human SYT5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
AdmiRa-rno-miR-511-3p Virus
mr0889 250 µL

AdmiRa-rno-miR-511-3p Virus

Sign In for Pricing
View Details
Nploc4 Mouse siRNA Oligo Duplex (Locus ID 217365)
SR417636 1 Kit

Nploc4 Mouse siRNA Oligo Duplex (Locus ID 217365)

Sign In for Pricing
View Details