Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-21R, Rat (HEK293, His)

IL-21R Protein, a receptor for interleukin-21, is a type I cytokine receptor. It forms a heterodimer with the common gamma subunit and associates with Janus kinase 1 (JAK1) . These interactions are pivotal for transducing the cellular responses initiated by interleukin-21, regulating immune processes and inflammatory pathways. IL-21R Protein, Rat (HEK293, His) is the recombinant rat-derived IL-21R protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

IL-21R Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-21r-protein-rat-hek293-his.html

Purity

97.80

Smiles

CLDLTCYTDYLWTITCVLETWSPNPSILSLTWQDEYEELQDKETSCSLHASGHNTTHMWYTCHMRLSQFMSDDVFTVNMMDQSSNSSQECGSFVLAESIKPAPPLNVTVTFSGRYDISWDSIYEEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNISLLPQEFQKDSSYQLQVRAAPQPGTSFRGTWSEWSDPIIFQTQAEEPEAGWDP

Molecular Formula

308977 (Gene_ID) Q5EBB1 (C20-P236) (Accession)

Molecular Weight

32-50 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STEAP3 (NM_018234) Human Recombinant Protein
PH33804M5 20 µg

STEAP3 (NM_018234) Human Recombinant Protein

Sign In for Pricing
View Details
CA 15-3 (Breast Tumor, 15-3, MUC1, MUC-1) (AP) discontinued
226859-AP 100 µL

CA 15-3 (Breast Tumor, 15-3, MUC1, MUC-1) (AP) discontinued

Sign In for Pricing
View Details
WDR36 AAV siRNA Pooled Vector
50325161 1.0 µg

WDR36 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human CASP8 (Caspase 8) CLIA Kit
MBS2531687-01 96 Tests

Human CASP8 (Caspase 8) CLIA Kit

Sign In for Pricing
View Details
Human CASP8 (Caspase 8) CLIA Kit
MBS2531687-02 5x 96 Tests

Human CASP8 (Caspase 8) CLIA Kit

Sign In for Pricing
View Details
CD40 (B Cell surface antigen CD40, Bp50, CD40L receptor, CD_antigen CD40) (PE)
MBS6404225-01 0.1 mL

CD40 (B Cell surface antigen CD40, Bp50, CD40L receptor, CD_antigen CD40) (PE)

Sign In for Pricing
View Details